KEGG   Halalkalicoccus jeotgali: HacjB3_14550Help
Entry
HacjB3_14550      CDS       T01271                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00010  Glycolysis / Gluconeogenesis
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01120  Microbial metabolism in diverse environments
hje01130  Biosynthesis of antibiotics
hje01200  Carbon metabolism
hje01230  Biosynthesis of amino acids
Module
hje_M00002  Glycolysis, core module involving three-carbon compounds
hje_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_14550
Enzymes [BR:hje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     HacjB3_14550
Membrane trafficking [BR:hje04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HacjB3_14550
Exosome [BR:hje04147]
 Exosomal proteins
  Proteins found in most exosomes
   HacjB3_14550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ADJ16291
UniProt: D8J922
Position
complement(2682230..2683279)
Genome map
AA seq 349 aa AA seqDB search
MSNNFENEPVRVGLNGFGRIGRNVFRAAMTSSKVELVGINDIMDVEDMHYLAKYDTVQGR
LDGLELEGDSLVYEGTEVPTFSEKDPTQLPWDELDVDVAFEATGIFRTREDAAQHLEAGA
EKVIISAPPKGETPVKTIVYGVNHDEYDGDDVVSNASCTTNSVAPVAKVLDEEFGIESGL
LTTVHAYTGTQNLVDGPSGKTRRGRAAAENIIPTSTGAAQSTTEVLPNLEGKLDGMAMRV
PVPTGSITDLVVDLAADVGAEEVNEALREAADGDLAGVLGYTDDEIVSRDIVGLPFSSYV
DLDSTIAVEGGQVKVLTWYDNEYGFANRMLDLAQYVVAQDEETPAEATA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataacttcgaaaacgaaccggtgcgggtgggactgaacgggttcgggcggatc
gggcggaacgtcttccgggccgcgatgacctcctccaaggtggagctggtggggatcaac
gacatcatggacgtcgaggacatgcactacctcgcgaagtacgacaccgtccagggtcgc
ctcgacgggctcgaactggagggcgactcgctcgtctacgagggcaccgaggtcccgacg
ttcagcgagaaggacccgacccagctcccgtgggacgaactggacgtcgacgtcgccttc
gaggcgacgggcatcttccgaacccgggaggacgccgcccagcacctcgaggccggcgcc
gagaaggtcatcatcagcgcgccgccgaaaggcgagacgccggtcaaaacgatcgtttac
ggcgtcaaccacgacgaatacgacggcgacgatgtcgtctcgaacgcctcctgtaccacc
aacagcgtcgcgccggtggcgaaagtactcgacgaggagttcggcatcgagtcggggctg
ctcaccaccgtccacgcctacacgggcacccagaacctcgtcgacgggccctcgggcaag
acgcgccggggccgggccgccgccgagaacatcatcccaacctcgacgggcgcggcccag
tcgaccacggaggtcctgccgaacctcgaaggcaaactcgacgggatggccatgcgcgtg
cccgttccgacgggctcgatcaccgacctcgtcgtcgacctcgcggccgacgttggggcc
gaggaagtaaacgaggcgctccgtgaggccgcggacggcgatctggccggcgtgctcggc
tacaccgacgacgagatcgtctcgcgggacatcgtcgggctccccttttcgtcctacgtc
gacctcgattcgaccatcgcggttgagggcgggcaggtcaaggtgctgacgtggtacgac
aacgagtacggcttcgccaaccggatgctcgacctcgcacagtacgtcgtcgcgcaggac
gaggagacgcccgccgaagcgacggcgtag

DBGET integrated database retrieval system