KEGG   Halalkalicoccus jeotgali: HacjB3_18618Help
Entry
HacjB3_18618      CDS       T01271                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00361  Chlorocyclohexane and chlorobenzene degradation
hje00625  Chloroalkane and chloroalkene degradation
hje01100  Metabolic pathways
hje01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hje00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HacjB3_18618
   00361 Chlorocyclohexane and chlorobenzene degradation
    HacjB3_18618
Enzymes [BR:hje01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     HacjB3_18618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like SurA_N_3
Motif
Other DBs
NCBI-ProteinID: ADJ17063
UniProt: D8JCF6
Position
p2:265818..266531
Genome map
AA seq 237 aa AA seqDB search
MSKIAAETIQEEASVLAFDLWDTLLDRESTLIPALDGLLTDHDCDYDPEILLRRYLAMHF
RDSMIDSLIPGPHTPFKEISRRALSYRLEQLGLDVPDEEIRRVIRQWKTLQPYPDVDSAL
DRLGDEYKLVGLSNGDPDMLNAVRPNFETELDGVVSVADAGAYKPHRASYDLCCDEFDVA
PHEVVFVTSHTFDLVGAKAVGMRGAFLNRHENPYGGWIHRPDLIVADTGELADVLTS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagattgctgcggagacaatccaagaagaagcgagcgttctcgccttcgatctg
tgggatacgctgctcgatcgtgaatcgacactaatccctgcattagatggattgctgact
gatcatgactgcgattatgatccagaaatcttactgcgacgctatctggcgatgcacttc
cgagactcgatgattgactcactgattcccgggcctcatactccgttcaaggagattagc
cgtcgagcgctcagttaccggttagagcaactcggtctcgatgtccctgacgaggaaatc
cgccgagtcatccgacagtggaagaccctacaaccctatccggacgtagactcagctctg
gaccgcttaggtgacgagtacaaattggtcgggctttcgaatggtgatccggatatgctc
aatgcggtacgtccaaacttcgagacagagctcgacggcgttgtatcggtcgctgatgct
ggcgcgtacaaaccacaccgagcgtcgtatgatctgtgctgtgacgaattcgatgtcgca
cctcacgaggtagtatttgtaacttctcatacattcgacctcgttggtgcaaaagcggtc
ggaatgcgcggggcattccttaacaggcatgagaacccgtatggcggctggatacaccgt
ccggatcttatcgttgctgataccggagaactggctgatgtgctaacttcttag

DBGET integrated database retrieval system