KEGG   Haematospirillum jordaniae: AY555_01250Help
Entry
AY555_01250       CDS       T04366                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo00071  Fatty acid degradation
hjo00072  Synthesis and degradation of ketone bodies
hjo00280  Valine, leucine and isoleucine degradation
hjo00310  Lysine degradation
hjo00362  Benzoate degradation
hjo00380  Tryptophan metabolism
hjo00620  Pyruvate metabolism
hjo00630  Glyoxylate and dicarboxylate metabolism
hjo00640  Propanoate metabolism
hjo00650  Butanoate metabolism
hjo00900  Terpenoid backbone biosynthesis
hjo01100  Metabolic pathways
hjo01110  Biosynthesis of secondary metabolites
hjo01120  Microbial metabolism in diverse environments
hjo01130  Biosynthesis of antibiotics
hjo01200  Carbon metabolism
hjo01212  Fatty acid metabolism
hjo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AY555_01250
   00630 Glyoxylate and dicarboxylate metabolism
    AY555_01250
   00640 Propanoate metabolism
    AY555_01250
   00650 Butanoate metabolism
    AY555_01250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AY555_01250
   00072 Synthesis and degradation of ketone bodies
    AY555_01250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AY555_01250
   00310 Lysine degradation
    AY555_01250
   00380 Tryptophan metabolism
    AY555_01250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AY555_01250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AY555_01250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AY555_01250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hjo04147]
    AY555_01250
Enzymes [BR:hjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AY555_01250
Exosome [BR:hjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AY555_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMW34022
UniProt: A0A143DBE3
Position
248917..250104
Genome map
AA seq 395 aa AA seqDB search
MTESVVILGGTRTAIGTFGGSLKEWTPCDLGALVIREALTRTAIAPTDVGHVVMGHIIPT
EPRDMYVSRVAACKGGIPDYVPAMTVNRLCGSGLQAILSAAHFIILGDCQIAVAGGTEVM
SRGSYILPAARWGARMGDSTMVDMMTGALTDPFGNGHMGVTAENVAAAHSISRDEQDCFA
AESHRRAAHAITSGFFKSQIAPVTIKTRGKETVFDTDEHVRPDTTLASLAKLKTLFREGG
SVTAGNASGINDGAAALVLMAEREASARKLTPMARIVSYGHAGVDPSLMGIGPVPASMIA
LKKAGLAVSDLDLVESNEAFAAQACAVNQKLGLDPEKVNPDGGAISLGHPVGATGAILVI
KAIYALHRTGGRYALVTMCIGGGQGIALTLERMGD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctgtggttattctggggggaacgcgaaccgcgattggcacctttggcggt
tcgctcaaggaatggacgccatgtgatctcggggcactggtgattagggaagccctgaca
cgaacggccattgcacccacagatgtcgggcatgtggtcatggggcatattatcccgact
gaaccacgggatatgtacgtctcccgcgtggctgcctgcaagggcgggattccggactat
gtcccggccatgaccgtcaatcgcctgtgtgggtcgggcctgcaggcgatcttgtccgca
gcgcactttattatactgggtgactgccaaatcgccgttgccggtggcacagaggtgatg
agccggggcagctacatactgccggccgcgcgttggggtgcccgcatgggcgacagtacc
atggtcgatatgatgacaggtgccctgacagacccatttggcaatggccacatgggggta
acagcagaaaatgtcgcggcagcacactcgatcagccgtgatgaacaggattgttttgcc
gcagaaagtcaccgtcgggcagcacacgccatcacatccggtttctttaaaagtcaaatt
gctcccgtaaccataaaaacgcggggcaaggaaacagtatttgatacagatgagcatgtt
cgccccgacacgactctggccagccttgcaaagctaaagaccctttttcgcgagggcggc
tctgtcaccgctggaaatgcatcaggcatcaacgatggcgcggctgcccttgtcctgatg
gcagagcgcgaggcatcggcccgcaagctcacccccatggcccggattgtcagctatggt
cacgcgggggtcgatccgtccctcatgggaataggaccggttcccgccagcatgatcgcc
ctgaaaaaggccggtcttgcggtgtccgatctggacctggttgaatccaacgaggccttt
gccgcacaagcctgtgctgtgaaccagaagcttggcctagacccagagaaagtgaacccc
gacggcggggctatttccttgggtcatcctgttggcgcaaccggtgccatactggttata
aaagccatatacgccctgcaccgtaccggtgggcgttatgccctggtgacaatgtgtatc
ggcggcgggcaaggcattgcactcaccttggaacgtatgggtgattga

DBGET integrated database retrieval system