KEGG   Haematospirillum jordaniae: AY555_01595Help
Entry
AY555_01595       CDS       T04366                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo00564  Glycerophospholipid metabolism
hjo01100  Metabolic pathways
hjo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AY555_01595
Enzymes [BR:hjo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AY555_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AMW34078
UniProt: A0A143DD79
Position
321183..321893
Genome map
AA seq 236 aa AA seqDB search
MKSVDVPWSRFLMPPLHEEGPRFLAVFAALALVLYLLTGWPGGLIGLVGTVWCFFFFRDP
VRYVPTRPGLMISPASGVVQMIGEMAPPPELGLGDTAVTRVSVFMSVFDCHVNRIPCAGE
IRSVVYKPGRFVNATLDKASEDNERNGLRIALPDGREYGVVQIAGLIARRIRCDVHEGQT
CQTGDRFGLIRFGSRLDIYLPPGTNPLVVLGQVCVSGETVLADLTADEPAREGKAL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatctgtcgacgtcccctggagccgcttcctgatgccccctctacatgaggagggg
cctcgttttcttgccgtcttcgcagctctggctcttgtcctgtacctgctgacagggtgg
cctggcggcctgatcggcttggttggtacagtgtggtgctttttcttcttccgcgatcca
gtgcgctacgtgccgacccgccccggacttatgatcagcccggccagcggtgtggtacaa
atgatcggggaaatggcccccccccctgaactgggattgggtgatacagcggtcacacgc
gtatccgtcttcatgagcgtgtttgactgccacgtcaaccggatcccgtgcgcgggtgaa
atacgctctgtggtttacaaaccgggacgattcgtaaatgccacactggacaaggccagc
gaagacaacgagcgtaacgggctacgcatcgccctgcccgatggccgggaatatggtgtc
gtacagattgccgggctgattgcgcggcgcattcgctgcgatgtgcatgagggccagact
tgccagaccggtgatcgttttggcctaattcgctttgggtcacgtctggacatttatctg
cctcccggcaccaaccccttggtggtccttggtcaggtttgcgtatctggtgaaaccgtg
ctggccgatctgacagcagacgaaccagcccgtgaaggaaaggctttataa

DBGET integrated database retrieval system