KEGG   Haematospirillum jordaniae: AY555_01905Help
Entry
AY555_01905       CDS       T04366                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo00071  Fatty acid degradation
hjo00072  Synthesis and degradation of ketone bodies
hjo00280  Valine, leucine and isoleucine degradation
hjo00310  Lysine degradation
hjo00362  Benzoate degradation
hjo00380  Tryptophan metabolism
hjo00620  Pyruvate metabolism
hjo00630  Glyoxylate and dicarboxylate metabolism
hjo00640  Propanoate metabolism
hjo00650  Butanoate metabolism
hjo00900  Terpenoid backbone biosynthesis
hjo01100  Metabolic pathways
hjo01110  Biosynthesis of secondary metabolites
hjo01120  Microbial metabolism in diverse environments
hjo01130  Biosynthesis of antibiotics
hjo01200  Carbon metabolism
hjo01212  Fatty acid metabolism
hjo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hjo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AY555_01905
   00630 Glyoxylate and dicarboxylate metabolism
    AY555_01905
   00640 Propanoate metabolism
    AY555_01905
   00650 Butanoate metabolism
    AY555_01905
  Lipid metabolism
   00071 Fatty acid degradation
    AY555_01905
   00072 Synthesis and degradation of ketone bodies
    AY555_01905
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AY555_01905
   00310 Lysine degradation
    AY555_01905
   00380 Tryptophan metabolism
    AY555_01905
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AY555_01905
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AY555_01905
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AY555_01905
Enzymes [BR:hjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AY555_01905
Exosome [BR:hjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AY555_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AMW34133
UniProt: A0A143DCY3
Position
377864..379039
Genome map
AA seq 391 aa AA seqDB search
MPDVVIVSATRTAIGAFNGSLSPLQAPELGSLVIREALRRASLEANTVSEVIMGQVLTGG
SGQNPARQASIKAGIPEHVPSWTLNMVCGSGLRAIIQGAMAIMADTADVVVAGGQESMSN
APHCAWLRSGIKMGSTELVDTMIRDGLWCAFNNYHMGNTAENIASRWGFTRQEQDAFAVH
SQQKAEAALRNGRFKDEIVPVKITGKKEESIFDQDEYPRAGTTIETLARLRPAFTKDGTV
TAGNASGLNDGAAAVVLMSADTAHKRGLKPLVRIKSFASAGVDPAIMGTGPIPATRKALE
KAGWTPDDLDLIEANEAFAAQAMSVNRELGWNTEKVNVNGGAIALGHPIGASGARVFVTL
VHEMQKREARKGLATLCIGGGMGVALAVEKV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatgttgtgattgtcagcgccacgcgtacggccattggcgcctttaacggcagc
ttgtcccctctgcaagccccggaacttggctctcttgttattcgtgaagcgctaaggcgg
gctagtcttgaagccaacacggtatcagaagtcatcatgggacaggtgctgacaggagga
tccgggcagaacccggcacggcaagcatccataaaagccggcatacccgaacacgttcca
tcttggacactgaacatggtgtgcgggtctggactgagagcaattatacagggcgccatg
gcgattatggcggatacggctgatgttgtggtcgctggcggtcaggaaagcatgagcaac
gcccctcattgcgcatggctgagatcgggcatcaagatgggatccaccgagttggtggac
acgatgattcgtgatggtttgtggtgcgctttcaataactaccatatgggtaatacagcg
gaaaatattgccagccgatggggctttacgcgtcaggagcaagatgcatttgctgtacat
tcccaacaaaaggctgaagccgccctgcgcaacgggcgattcaaggacgaaattgtccct
gtcaaaatcacaggcaagaaagaagaaagtatttttgatcaggatgaatatccacgtgcc
ggtaccacaatcgagacactggcacgcctgcgtcctgccttcacaaaagatgggactgtc
acagctggaaatgcctccggcctcaacgatggtgcagccgccgttgttcttatgtctgca
gacaccgcacacaaaagaggcctgaaaccactggtgcgcatcaaatcttttgcctctgct
ggcgttgatccggccatcatggggacaggcccgatcccggcgacacgcaaagccttggaa
aaggcgggatggacaccggatgatctagatctgatagaagccaatgaggcctttgccgcc
caagccatgagcgtaaaccgggaactaggctggaatacagagaaggtcaacgtaaatggc
ggcgctatcgctcttgggcatcctatcggtgcatccggcgcccgtgtctttgtcaccctt
gtgcacgaaatgcaaaaacgagaagccagaaagggcctagcaacgctctgcattggcggt
ggaatgggcgttgccttggcagtagagaaagtgtga

DBGET integrated database retrieval system