KEGG   Haematospirillum jordaniae: AY555_06960Help
Entry
AY555_06960       CDS       T04366                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo00860  Porphyrin and chlorophyll metabolism
hjo01100  Metabolic pathways
hjo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hjo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AY555_06960
Enzymes [BR:hjo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AY555_06960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AMW34962
UniProt: A0A143DDZ2
Position
complement(1479692..1481041)
Genome map
AA seq 449 aa AA seqDB search
MNHDLLNKYNLRLPRYTSYPTAPHFSAAVTPDLYRTWLETLDPETPVSLYLHVVYCAEMC
WFCGCHTKITKRYAPIAEYLETLLQEIDLVANALPARFTAKHIHFGGGSPTILSAPDFTR
LMQRLKNCFSFSPDAETAVELDPRTADEAYIQAMAAAGVNRASVGVQDFNHKVQETVNRI
QPFELVASVFKWLRRHGIDRINMDLMYGLPYQTTASILDTVDRAVSLGPQRISLFGYAHV
PWMRKHQTLLPEDCLPGFRDRWEQYEAATKRLHQYGYVSIGLDHFALANDTMAIAQTEKR
LNRNFQGYTTDTAPVLLGMGASGIGSLPQGYVANEGEVHAWRRMISGGILPIRRGIAISD
EDRMRRMVIERLMCDLEVDLGDIASSFGRGHDYFTPELNGMQDLEKDNLVIRHEHMLRMT
EEGRPLVRVAAARFDQYLKQGELKHSKAI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgatctgctgaacaaatacaatctgcggcttccgcgttacaccagctatcca
acggcaccgcacttctcggcggccgtaacaccggatctctaccggacatggctggaaaca
ctggaccccgaaacaccggtatccctgtatctgcacgtggtttactgtgctgaaatgtgc
tggttctgcggatgtcataccaaaatcaccaagcggtatgcgcccattgcagagtacctg
gaaaccctgctgcaggaaattgaccttgtggccaatgcccttccggcacgtttcacggcc
aagcatatccactttggggggggcagtcccaccatcctgtcggcacctgacttcacgcgg
ctgatgcaacgcctcaagaactgtttctcgttttcccctgatgcagaaacagccgtcgag
ctggatccccgtacagccgatgaagcctacatccaggccatggcagcagccggtgtaaac
cgggcatctgttggtgtgcaggacttcaatcacaaggtacaggaaaccgttaaccggatt
cagcctttcgaactggttgcctcggtattcaagtggctgcgccggcacggtattgaccgg
atcaacatggacctgatgtatggactaccctaccagaccaccgccagcattctggatacg
gtggaccgggctgtcagtctggggccacagcgtatttcactgttcggctatgcccatgtt
ccctggatgcgcaagcaccagaccttgttgcccgaagactgcctgcccgggttccgggac
cgatgggagcagtacgaagctgccacaaagcgcctgcatcagtatggctatgtcagtatc
ggactggatcactttgcccttgccaacgatacgatggccattgcccagaccgagaagcgg
ctgaaccggaattttcaggggtatacaacagataccgcccccgttcttttgggtatgggc
gcatcgggcattgggtccctgccccaaggatacgttgccaacgagggggaggtgcacgcc
tggagacgcatgatctccggtggtatcctgccaattcgtcgcggcattgccatatccgat
gaagaccgtatgcgacgcatggttattgaacggctgatgtgcgacctagaggttgacctt
ggtgacatagcctcatctttcgggcgcggacatgactatttcacccctgaattgaatggg
atgcaggacttggagaaagacaacctggttatccggcacgaacacatgctgcgcatgaca
gaagagggaaggccgttggtccgcgtcgccgcagcacgttttgaccaatatctgaaacaa
ggcgaactcaagcactccaaggctatataa

DBGET integrated database retrieval system