KEGG   Haematospirillum jordaniae: AY555_07035Help
Entry
AY555_07035       CDS       T04366                                 

Definition
(GenBank) glutamine--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo00860  Porphyrin and chlorophyll metabolism
hjo00970  Aminoacyl-tRNA biosynthesis
hjo01100  Metabolic pathways
hjo01110  Biosynthesis of secondary metabolites
hjo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hjo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AY555_07035
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AY555_07035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hjo01007]
    AY555_07035
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hjo03016]
    AY555_07035
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hjo02048]
    AY555_07035
Enzymes [BR:hjo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     AY555_07035
Amino acid related enzymes [BR:hjo01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   AY555_07035
Transfer RNA biogenesis [BR:hjo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AY555_07035
 Prokaryotic type
   Other AARSs
    AY555_07035
Prokaryotic defense system [BR:hjo02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    AY555_07035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AMW34970
UniProt: A0A143DEL9
Position
1498066..1499403
Genome map
AA seq 445 aa AA seqDB search
MSVRVRFAPSPTGALHMGNIRLAVINFLLAGGDPGRFVLRYDDTDQERSRPEFIEGIARD
LRWLGIEWGQEFFQSRRLDLYVQARDRLIADGRLYPCYETPEELEYMRNRQRARGLPPVY
DRSALALTSEQKETLEQQGRRPHWRFRLDPGEIRWTDLVRGECVYNAAHLADPVVIREDG
SFLYLLPSVVDDVAMGITHVVRGEDHVTNTAVQIQMFQALGGNLPAFAHLPLLVGADGHK
LSKRSGSLSVAELRDKGVEPLAVHALLARLGSSEAVEPVQDVQGLIQDFDLGRFGRGAPR
LDEADLMRLTEKLVHGMGWDQVAQRLRSLGCDLADESFWLAVRPNVQTVADTLPWYRILH
GPMVPVCEDAAFLTEAASLLPPEPWDEQTWKQWTGAVSTHTGRKGKALFMPLRLALTGLD
HGPELKVLLPLLGRGRVLQRLGCAA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcgtgttcgctttgctccttcccccaccggtgcccttcatatgggcaatatc
cgtctggctgttattaatttcttgcttgcaggcggtgatccggggcgctttgtgctgcgc
tatgatgatacagaccaagagcgttctaggcctgagttcatcgaaggcatagcccgtgac
ctgcgctggttgggcattgaatgggggcaggagtttttccagtcgcgtcgacttgatctg
tatgtgcaggcgcgggaccgcctgattgctgatggtcgcctgtacccttgttacgagaca
cccgaagaactggaatatatgcgcaaccggcagcgtgcacggggcctgcctcctgtttat
gaccgctcggcattggcgctgacatcggagcagaaggaaaccctagagcaacaggggcgg
cgcccgcactggcgattccggcttgatcccggagagatacgctggacggacttggttcgt
ggtgagtgtgtttataatgcagcccacttggctgatccggtggtgattcgggaagatggc
agctttttgtatctattgccgtcggttgttgacgatgttgcgatgggcataacccatgtt
gtgcggggtgaggatcacgtgaccaatacggcggtccagatccagatgttccaagccttg
ggggggaatctgccggcgtttgctcatctccctctgttggttggagcggatgggcacaag
ctgtccaagcgcagtggtagtttgtctgtggcagaattgcgcgataagggggttgagcca
ctggctgtccatgcccttctggcgcgccttggctcttcagaggcggtggagccggttcag
gatgtgcagggtctgatccaggattttgatctcgggcgctttggacgtggtgccccgcgg
ctggatgaagcagatctcatgcgtctgacagagaaactggtccatggcatgggctgggat
caggttgctcaacgccttcggtccttgggttgtgatttggccgacgagtccttctggtta
gctgtccgcccgaacgtgcaaacggttgccgataccctgccatggtaccgtattttgcat
ggcccaatggttcctgtttgcgaagatgcagctttcttgactgaagctgcttccttgctt
ccgccagagccatgggacgagcagacttggaagcagtggacgggggctgtgtccacgcac
accgggcgaaaaggcaaagccttgtttatgccactgcgcttggccctgactggcttggat
catggtccggagcttaaggttcttctgcccttgctcgggcgtggtcgcgttctgcagcgg
ctggggtgtgccgcctaa

DBGET integrated database retrieval system