KEGG   Haematospirillum jordaniae: AY555_08465Help
Entry
AY555_08465       CDS       T04366                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo00450  Selenocompound metabolism
hjo00970  Aminoacyl-tRNA biosynthesis
hjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hjo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AY555_08465
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AY555_08465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hjo01007]
    AY555_08465
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hjo03016]
    AY555_08465
Enzymes [BR:hjo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AY555_08465
Amino acid related enzymes [BR:hjo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AY555_08465
Transfer RNA biogenesis [BR:hjo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AY555_08465
 Prokaryotic type
   Other AARSs
    AY555_08465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AMW35199
UniProt: A0A143DF39
Position
1792018..1793577
Genome map
AA seq 519 aa AA seqDB search
MTGSRSYYVTTPIYYVNDRPHIGHAYTTLACDVLARFKRLDGYRVMFLTGTDEHGQKVEK
SAHAKGIDPQVFTDEVSQNFRDLASVMKYSHDDFIRTTEPRHKAACAALWKRLVDRGDIY
AGKYAGWYAVRDEAFYAESELQTAPDGTRIAPTGAPVEWVEEPSYFFRLSAWQDKLLRFY
DEHPDFIAPESRRNEVISFVQGGLQDLSVSRTTFRWGVPVPGDSEHIMYVWLDALTNYLT
ATGYPDTGHERYKAFWPADLHMVGKDILRFHAVYWPAFLMAADLPLPKRVFAHGWWTNEG
QKISKSLGNVIDPYELVGTFGLDQTRYFLLREVPFGNDGVFSRQAFVRRMNTELANDLGN
LVQRTLSMIAKNCSGKVPEVGVLEDSDRHMLDSAYSLLDVLREQLDRQAFHEALESIWVV
VRAANAYVDHQAPWSLRKTDPKRMETVLWVLAESIRQVALLMQAFVPDGAGRILDQLGLG
QEQRGFDTFGPRFALVTGSDLPAPQGIFPRYAEEEVVRS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggtcaaggtcttattacgtcacaaccccgatttattatgtgaatgaccgccca
catatcggtcatgcctataccaccttggcatgcgatgtgctggcccgtttcaagcggctg
gacgggtatcgggtgatgtttctgaccggaaccgatgaacacgggcaaaaagtcgagaaa
tcagctcatgcaaaagggatagatcctcaggtctttacagatgaggtttcccagaacttc
cgtgatcttgcatcggtcatgaaatacagccatgacgactttatccgcacgaccgagccg
cgccacaaggctgcttgcgctgcgttgtggaagaggcttgtcgacagaggcgatatttac
gctggaaaatacgcaggctggtatgccgtgcgggacgaagcattttatgcagaaagtgag
ttgcaaacggcgcccgacggcacgcggattgctccaacaggtgctcctgtggagtgggtg
gaagaaccaagctattttttccgtctttcggcctggcaggacaagctgctgcggttttat
gacgagcatccagactttattgcgccggaaagccgccgcaacgaggtgatcagtttcgtt
caaggtgggttgcaggatttgtcggtatcccgcaccacgttccggtggggtgttcccgtg
ccgggcgacagcgagcatattatgtacgtctggctggatgccctgaccaattacctgaca
gcaacaggttatcctgatacagggcatgagcgatacaaggcgttctggcccgcagatctg
catatggttggcaaagatattctgcgctttcacgctgtttactggccagccttcctgatg
gcagccgatttgcccctgccaaagagggtctttgcccatggctggtggacgaatgaaggg
caaaagatttccaagtcgttgggtaatgtcattgatccctacgaactggtcggaacgttc
ggtcttgatcagacccgttactttttgctgagagaagttccttttggcaatgacggtgtg
ttttcgcgtcaggcctttgtccggcggatgaatactgaactggccaatgaccttggaaac
ttggtccagagaactttgtccatgattgccaagaactgtagtggcaaggtcccggaggtt
ggcgttttggaagacagcgaccgccacatgctggactccgcttatagtctgctggatgtc
ttgagagagcagctggatcgtcaggcgttccacgaggctttggagagtatctgggttgtt
gtacgggctgccaacgcctatgtcgatcaccaagccccttggtccttgcgcaagacggat
cccaagcggatggaaactgttctctgggtgttggctgagtcaattcgtcaggttgcgctt
ttgatgcaggcgtttgttccggatggggccgggcggattctggatcagttgggtctgggg
caagaacagcgtggctttgacacatttggtccccggtttgcacttgttacaggatcggac
ctgcctgcgccgcagggtatcttcccccgctatgccgaggaagaggttgtgcgttcgtga

DBGET integrated database retrieval system