KEGG   Haloterrigena jeotgali: DVR14_00140Help
Entry
DVR14_00140       CDS       T05948                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hjt  Haloterrigena jeotgali
Brite
KEGG Orthology (KO) [BR:hjt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DVR14_00140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QCC57124
UniProt: A0A4D6HSZ4
Position
unnamed1:complement(24059..25237)
Genome map
AA seq 392 aa AA seqDB search
MVETLLAIGIVASLFVGFNIGGSSTGIAWGPPVGAGIVKKTTAAALMTFFVFLGGWTVGR
NVMDTLSEGIITIDLTLTAGVAVLFFIGLGILIANIFGVPVPTSMTTVGAIAGLGLATDT
LNYATIAEIVSWWVVTPIIGFWIGGIIGRYIYPEVNRRVQIEKSDGPLLTLDRDGTLPKP
TFGPNTTWAELGTTVVVLVIGCYMAFSAGASNVPNAAAPLVGGVGGLPDDTAIIIATLAI
GLGGFTIARRTMESVGGELSDIPLLAALFVMLTASTITTLLSWIGIPISLVMATVMTIVG
IGWGRATRPITFREAVTRDTGEPEIVPGAITAEEMEGKPAAPIGEEEPEEVLKAGDLFNP
RAIMKYISMWIIGPSVSTILAYGFFILIPGVA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaccctactcgcaattgggatcgttgcgtctctttttgtcgggttcaatatt
ggtggctcatctaccggaattgcgtgggggccacccgtcggtgctggtatcgtcaaaaag
acgacggcagcagcactcatgacgtttttcgtctttctcggtgggtggactgtcggacgg
aacgtgatggacacgctgagcgaaggtatcatcacgattgatctcacgctgacggctggc
gtcgctgtcctcttcttcattggactgggcatcctcatcgccaatatcttcggcgttccc
gttccaacgtcgatgacgaccgttggcgcgatagccggtcttggactcgcaacagacaca
ctcaactacgcgaccattgccgagattgtctcgtggtgggtcgtcacgccgatcatcggg
ttctggattggcgggattattggacgatacatctatccagaagtcaaccgacgggtacag
attgagaaatcagatggcccattactgaccctcgaccgggatggaacgcttccgaagccc
acgttcggcccaaacacgacgtgggcagaactcggtaccacagtagttgtgctcgttatc
ggctgttacatggcgttcagcgccggggcaagcaatgtcccgaacgctgccgcgccactg
gtcggcggagtaggcggactccctgacgatacggcaatcatcatcgctacgcttgcgatt
ggactcggtgggttcaccattgcccgccggacgatggaatctgtcgggggcgaactgagt
gacatcccgctgctcgcagccctcttcgtcatgctcacagcatcaacgattacaacgctt
ctctcgtggatcgggattccaattagtctcgtgatggcgacggtgatgacaatcgtcggg
atcgggtggggtcgtgcaactcgcccgattacttttcgtgaggccgttactcgggacacg
ggcgaacccgagatcgtccccggtgcaatcaccgccgaagagatggaagggaaaccagcc
gcgccaatcggagaagaggaaccagaagaggtgctcaaggcgggtgatctgttcaatccc
cgagcgataatgaaatacatctcgatgtggattatcggcccgtccgtgtctacgatcctc
gcctacgggttcttcatcctcatcccgggagtcgcctga

DBGET integrated database retrieval system