KEGG   Haloterrigena jeotgali: DVR14_08565Help
Entry
DVR14_08565       CDS       T05948                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hjt  Haloterrigena jeotgali
Pathway
hjt00260  Glycine, serine and threonine metabolism
hjt01100  Metabolic pathways
hjt01110  Biosynthesis of secondary metabolites
hjt01120  Microbial metabolism in diverse environments
hjt01130  Biosynthesis of antibiotics
hjt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hjt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DVR14_08565
Enzymes [BR:hjt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DVR14_08565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: QCC58674
UniProt: A0A4D6HWT0
Position
complement(1375434..1376450)
Genome map
AA seq 338 aa AA seqDB search
MIDFRSDTVTTPDEAMREAAATAAVGDDVYGEDPTVNELEARVADRLGTEAALYFPTGTM
ANQTAARVHTEPGQEVIADRESHVVKYELGGLAQHSGLQLRTLDADRGVPSPSRVDAAIV
DEDLHRPGTGLCCLENTHNARGGLAIEPEAIAAAATAARERGVSVHLDGARLFNAATALD
VSVAELAAPVDSVMVSLSKGLGAPVGSMLAGSDEFVERARRTRKLFGGGMRQAGIVAGPA
LEALENVADLERDHENARQLAAGLDDIDGFDVREPETNIVIADVSGTGEAPSTVVDRLGE
RDVLASPFGPTTVRFCTHRDVSRGDIERALERIGDEFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattgacttccgaagcgataccgtcaccactcccgacgaagcgatgcgcgaggccgcc
gccaccgccgcggtcggggacgacgtctacggcgaggacccgacggtgaacgaactcgag
gcccgcgttgccgaccgcctcggtaccgaggcggcgctgtactttccgaccgggacgatg
gcgaaccagaccgccgcccgcgtccacaccgagcccgggcaggaagtgatcgccgatcgg
gagagccacgtcgtcaaatacgaactcggcgggctggcacagcactccgggctccagctc
cggacgctcgacgccgaccgcggggttccttcgccctcgcgggtcgacgcggcaatcgtc
gacgaggacctgcaccgccccggcaccggactgtgctgtctcgagaacacgcacaacgcc
cgtggcgggctcgcgatcgaacccgaggcgatcgccgcggcggctacggccgcccgcgag
cgcggcgtgtcagtccacctcgacggcgcgcgactgttcaacgccgcgacggcgctcgac
gtttccgtcgccgaactcgcggcgccggtcgactccgtcatggtctcgctctcgaaggga
ctgggtgcgcccgtcggttcgatgctcgccggcagcgacgagttcgtcgaacgggcccgc
cggacgcggaaactgttcggcggcgggatgcgccaggccgggatcgtcgccgggccggcc
ctcgaggcgctcgagaacgtcgccgatctcgagcgggatcacgagaacgcgcggcaactg
gccgcgggactcgacgacatcgacgggttcgacgttcgagagcccgagacgaacatcgtc
atcgcggacgtctcggggacgggcgaggctccgtcgaccgtcgtcgaccgcctcggtgag
cgggacgtgctggcgtcgccgttcggcccgacgacggtccggttctgtacgcaccgtgac
gtctcccgcggggacatagagcgggcgctcgagcgaatcggcgacgagttcgcctga

DBGET integrated database retrieval system