KEGG   Halorubrum lacusprofundi: Hlac_0730Help
Entry
Hlac_0730         CDS       T00856                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00010  Glycolysis / Gluconeogenesis
hla00071  Fatty acid degradation
hla00350  Tyrosine metabolism
hla00625  Chloroalkane and chloroalkene degradation
hla00626  Naphthalene degradation
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01130  Biosynthesis of antibiotics
hla01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_0730
  Lipid metabolism
   00071 Fatty acid degradation
    Hlac_0730
  Amino acid metabolism
   00350 Tyrosine metabolism
    Hlac_0730
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hlac_0730
   00626 Naphthalene degradation
    Hlac_0730
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Hlac_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACM56332
UniProt: B9LUH5
Position
1:744693..745733
Genome map
AA seq 346 aa AA seqDB search
MQAARLHEYTDDMSEGLAIDEVDRPHATGPSDVIVEVEGAGWCQTDNHIIEGMWEEYVPQ
TLPMTLGHENAGTVVETGDDVDIVSEGDPVICHPVQTCGTCRPCRLGETMYCENSAFNGL
TTDGGFAEYLHTSERSVIPLPSGVDPIDIAPHADAGITAYHAVKKAVADLNPGDHAVVIG
VGGLGHIGLQCLDAMSAARITAVDLKESALDLAEGYGADHLINPSDDDVREELAGITDGT
GAAQVLDFVGADITTAYAPDITAAGGDHHIIGYGGHVHEPAQALVNGEFSFVGNIVGRYA
ELQELVALVEQGEVDLHTSRYDLGEVNTVAEKLEHGEIDGRAVITP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagctagactccacgagtacaccgacgacatgagcgaggggctcgcgatcgac
gaggtcgaccgtccgcacgccacgggcccgagcgacgtgatcgtcgaggtcgagggcgcg
ggctggtgccagacggacaaccacatcatcgaggggatgtgggaggagtacgtcccccaa
actcttcccatgactcttggccacgagaacgccgggacggtcgtcgagacgggagacgac
gtagatatcgtctctgagggcgaccccgtgatctgtcacccggtccagacctgcggcacc
tgtcgcccctgccggctcggcgagacgatgtactgcgagaacagcgcgttcaacggactc
accacggacggcggcttcgccgagtacctccacaccagcgagcgctcggtgatcccgcta
ccgtccggcgtcgatccgatcgacattgcgccccatgccgacgctgggatcacggcgtat
cacgccgtaaagaaggcggtcgcggatctgaatcccggcgaccacgcggtcgtcatcggc
gtcggcgggctcggccacatcggcctgcagtgcctagatgccatgagcgcggctcggatc
accgcggtcgacctgaaggagtcggcgctcgacctcgcggaggggtacggtgccgaccac
cttatcaacccgagcgacgatgatgtccgcgaggagcttgccggaatcaccgacgggacg
ggcgccgcacaggtgcttgacttcgtcggggcggacatcactaccgcatacgcgccggac
atcaccgcggccggcggcgaccaccacatcatcggctacggtggacacgtccacgagccg
gcccaggcgctggtgaacggcgaattctccttcgtcggcaacatcgtcgggcggtacgcg
gagctgcaggagctggtcgcgctcgtcgaacagggcgaggtggatctccacaccagccgg
tacgatctcggtgaggtgaacacggtcgcggagaagctcgaacacggcgaaatcgacggt
cgcgccgtgatcacgccctga

DBGET integrated database retrieval system