KEGG   Halorubrum lacusprofundi: Hlac_0797Help
Entry
Hlac_0797         CDS       T00856                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00030  Pentose phosphate pathway
hla01100  Metabolic pathways
hla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hlac_0797
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Hlac_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACM56396
UniProt: B9LUR9
Position
1:799084..800154
Genome map
AA seq 356 aa AA seqDB search
MNAIAVYDGADEPVVTEKPRPEPAPGEALVRTLRVGVDGTDHEVISGSHGGSPEGEDHLV
LGHEAVGVVEEPTDTPFEVGDIVVPTVRRPPNGANEYFARGEPDMAPDGQYHERGIVGAH
GFMAEYFTSPAEFLVEIPPALAEWGFLVEPVSIAEKAIEHAYASRSAFHWEPESALILGN
GSLGLLTVATLDDGFDRIYCLGRRERPDPTIDIIESLDATYVNSNETPVPSVPAAHEPMD
FVFEATGYAPHAFETIEALAPNGVGALLGVPGDWEFEIDGGRLHREFVLHNKALVGSVNS
GYEHFEAAVDSLSRFSETFLDDLVTGVHGLDEFEAAFADDDTTIKTAVEFGTYEER
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgatcgccgtgtacgacggggcagacgaaccggtcgtcacagagaagccgcga
ccggagccagcgcccggggaggcgctggttcgaaccctccgggtcggcgtcgacgggacc
gaccacgaggtcatctccgggagccacggcggctctcccgaaggcgaggatcacctcgtg
ttgggtcacgaggcagtcggcgtggttgaagagccgaccgacacgccgttcgaggtcgga
gatattgtggtaccgacggtcaggcgaccgcccaacggggcgaacgagtacttcgctcgc
ggcgagccagacatggcgccggacgggcagtaccacgagcgcggcatcgtcggggcccac
ggattcatggcggagtacttcaccagtcccgcggaattcctcgtcgagatcccgccggcg
ctggctgagtgggggttcctcgtcgaacccgtctctatcgcggagaaggcgatcgaacac
gcctacgccagccggtccgcgttccactgggagccggagtcggcgttgattctcggaaac
ggctcgctcgggctgctgacggtcgcgactctcgacgacgggtttgaccggatctactgt
ctcggccgccgcgagcgcccggacccgacgatcgatatcatcgagtcgctcgacgcgacg
tacgtcaactccaacgagacgcccgtcccctcggtgccggcggcccacgagccgatggac
ttcgtcttcgaggcgaccggctacgccccgcacgccttcgagacgatcgaggcgctcgcg
ccgaacggggtgggcgcgctgctcggggtcccgggcgactgggagttcgagatcgacggc
ggccgactccaccgggagttcgtccttcacaacaaggcgctcgtcggcagcgtcaactcc
ggctacgagcacttcgaggccgccgtcgactcgctgtcccgcttttccgagacgttcctc
gacgatctcgtcacgggcgtgcacgggctcgacgagttcgaggccgcgttcgcggatgac
gacacgactattaaaacggcggtcgaattcggtacatatgaagaacgttga

DBGET integrated database retrieval system