KEGG   Halorubrum lacusprofundi: Hlac_1271Help
Entry
Hlac_1271         CDS       T00856                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01130  Biosynthesis of antibiotics
hla01230  Biosynthesis of amino acids
Module
hla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hlac_1271
Enzymes [BR:hla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hlac_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth NMO NanE QRPTase_C ThiG IMPDH DHO_dh
Motif
Other DBs
NCBI-ProteinID: ACM56863
UniProt: B9LNC5
Position
1:1281611..1282420
Genome map
AA seq 269 aa AA seqDB search
MDDQTELAPAVRSILSAARNRATEGRSGEVAVEPRDLRAAFDRAEADGRVPLIAEVKPTS
PTTEGTREDDPVALAQGMVAGGAAALSVLTEPAHFGGSTDTLERVREAVDVPVLRKDFLV
AESQLDAVESDVVLLIARFVGDDLPDLLTAARDRGFQVLVEVHDRDELEHALDAGATIIG
VNNRDLAELVVDLGTFESVAPHVPDDVTLIAESGIGSPADVRRMRAAGADALLVGSAIMD
GDVEANTRELVRAEADDESDTRDTTETPT
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcaaaccgagctggccccggcggtcagatcgatcctgtcggctgcacgcaac
cgcgcgaccgagggccgatccggcgaggtcgccgtcgagccgcgcgatctgcgggcggcg
ttcgaccgcgccgaggcggacgggcgcgtcccgctgatcgccgaggtgaaacccaccagc
ccgacgacggagggcacccgcgaggacgacccggtcgcgctcgcacagggaatggtcgcc
ggcggcgcggccgcgctgagcgtgctcaccgagccggcgcacttcggcgggagcaccgac
acgctcgaacgcgtgcgcgaggcggtcgatgtgcccgtcctccggaaggacttcctcgtc
gccgaatcgcaactcgacgccgtcgagagcgacgtcgtcctgctgatcgcccggttcgtc
ggcgacgacctccccgacctgctcaccgctgcgcgcgaccgcggcttccaggtcctcgtc
gaggttcacgaccgcgacgagctagagcacgcactcgacgccggcgcgacgatcatcggc
gtgaacaaccgcgacctcgcggaactggtcgtcgacctcggaaccttcgagtcggtggcg
ccccatgttcccgacgacgtgacgctgatcgccgaaagcgggatcggctcgcccgccgac
gttcggcggatgcgcgcggcgggcgccgacgccctcctcgtcgggagcgcgatcatggac
ggcgacgtggaggcgaacacgcgcgagttggtgcgggcggaggcagacgacgagagcgac
acccgagacaccacggagacacccacatga

DBGET integrated database retrieval system