KEGG   Halorubrum lacusprofundi: Hlac_1646Help
Entry
Hlac_1646         CDS       T00856                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00790  Folate biosynthesis
hla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hlac_1646
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hla04147]
    Hlac_1646
Enzymes [BR:hla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Hlac_1646
Exosome [BR:hla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hlac_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ACM57231
UniProt: B9LPE3
Position
1:1669147..1669497
Genome map
AA seq 116 aa AA seqDB search
MSSPLADEPVEPADEGAEPLTDDEYAEYLAELGPVWEVVDDHHLEATYEFDDFADALAFT
NEIGELAEAEGHHPDLHLSWGEVGVEMWSHDIGGLHESDFVMAARMDRIYDGDGGD
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaccgctcgcagacgagccagttgagccggccgacgagggagccgaaccgctc
accgacgacgagtacgccgagtatctcgccgaactcggtccggtgtgggaggtcgtcgac
gaccaccacctcgaagcgacctacgagttcgacgacttcgcggacgcgctggcgttcacg
aacgagattggcgaactcgccgaggcagaggggcatcaccccgatctccacctctcgtgg
ggcgaggtcggcgtcgagatgtggagccacgacatcggcgggctccacgagtccgatttc
gtgatggccgcgcggatggatcgtatctacgatggggacggcggcgactga

DBGET integrated database retrieval system