KEGG   Halorubrum lacusprofundi: Hlac_1672Help
Entry
Hlac_1672         CDS       T00856                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00010  Glycolysis / Gluconeogenesis
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01130  Biosynthesis of antibiotics
hla01200  Carbon metabolism
hla01230  Biosynthesis of amino acids
Module
hla_M00002  Glycolysis, core module involving three-carbon compounds
hla_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_1672
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Hlac_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 GFO_IDH_MocA 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACM57257
UniProt: B9LPG9
Position
1:1692890..1693954
Genome map
AA seq 354 aa AA seqDB search
MIRVGVNGYGTIGKRVADAVAAQPDMELVGVTKTSPDYGAEVALRRGYDLYAAIDDRAAA
FEDAGLAIAGSLGDLLDAVDVIVDCTPAGIGERNRPIYEAHDTPAIYQGGEDAAIADASF
NARASGAIGDAGSLRVVSCNTTGLSRLLAPLDEAYGIEKARVTLVRRGGDPSETDRGPIN
DVVPDPATVPSHHGPDVNAILPDVDIDTAALKAPVTGMHTHSVNVTLEREPTTAEVRELL
REETRLFLIPERAGIDGAGALKDYASDLGRDRGDLWENCIWEESISVEGRDLYLFQNVHQ
EADVVPENVDAIRALATDISREESVARTNEALGVGLDSLLSKDGATRDQVAADD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcgtgggcgtcaacgggtacgggacgatcgggaaacgcgtcgcggacgcggtc
gcggcccaaccggatatggaactcgtcggcgtaacgaagacgagtccggattacggcgcc
gaggtcgcgctccggcgcggatacgacctgtacgccgcgatcgacgaccgggccgccgcg
ttcgaggacgctgggctcgcgatcgccgggagcctcggcgatctgctcgacgccgtcgac
gtgatcgtcgactgcacgcccgccggaatcggggagcgcaatcgaccgatctacgaggcc
cacgacacacccgcgatctatcagggcggcgaggacgccgcgatcgcggacgcctccttc
aacgcccgcgccagcggggcgatcggcgacgccggctcgctccgcgtcgtctcctgtaac
acgaccgggctctcgcggctcctcgccccgctcgacgaggcgtacggcatcgagaaggcc
cgcgtgaccctcgttcggcggggcggcgacccgagcgagaccgatcgtggtccgataaac
gacgtagtgccggacccggcgacggtcccctctcaccacggtcccgacgtgaacgcgatc
ctcccagatgtcgacatcgacacggccgcgctgaaggcgccggtcaccggcatgcacact
cacagtgtcaacgtcacgctcgaacgggagccgaccacggcggaggtgcgggaactgctc
cgcgaggagacgcggctgttcctgatccccgagcgcgccggtatcgacggcgctggggcc
ctgaaagactacgcgtccgatctcgggcgggaccgcggcgacctctgggagaactgcatc
tgggaggagtcgataagcgtcgaggggcgggacctatacctgttccagaacgtccaccag
gaggcggacgtggtgcccgagaacgtcgacgcgatccgcgcgctggcgaccgatatctcc
cgagaggagtcggtggcgcggacgaacgaggcactcggcgtcgggctcgacagcctgttg
tccaaggacggagctacccgcgatcaggtcgctgcagacgactga

DBGET integrated database retrieval system