KEGG   Halorubrum lacusprofundi: Hlac_2256Help
Entry
Hlac_2256         CDS       T00856                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00010  Glycolysis / Gluconeogenesis
hla00030  Pentose phosphate pathway
hla00051  Fructose and mannose metabolism
hla00052  Galactose metabolism
hla00230  Purine metabolism
hla00500  Starch and sucrose metabolism
hla00520  Amino sugar and nucleotide sugar metabolism
hla00521  Streptomycin biosynthesis
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_2256
   00030 Pentose phosphate pathway
    Hlac_2256
   00051 Fructose and mannose metabolism
    Hlac_2256
   00052 Galactose metabolism
    Hlac_2256
   00500 Starch and sucrose metabolism
    Hlac_2256
   00520 Amino sugar and nucleotide sugar metabolism
    Hlac_2256
  Nucleotide metabolism
   00230 Purine metabolism
    Hlac_2256
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hlac_2256
Enzymes [BR:hla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hlac_2256
    5.4.2.8  phosphomannomutase
     Hlac_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACM57832
UniProt: B9LRV8
Position
1:complement(2244256..2245617)
Genome map
AA seq 453 aa AA seqDB search
MELFGSSGIRGVALRYLTPELVLGIAKAAGTTWDADRVAVARDTRTTGELFANAAASGLA
AVGCDVDRLGVVPTPAVGNYCESAGIPCVLVTASHNPPEFNGIKLVGDDGVELSVDVLER
VERRVLDDEYDHADWRNAGATTRVECAVDDYVDQLLDAVDREAIADANLTVAVDPGHGAA
SVSSPRIYRELGCEVLTVNATPDGHFPGRDSEPVPENLDDLQRLVATTDADVGIAHDGDA
DRAVFVDENGEFVDGDTSFAVMADACLEPGDAVVSAVNVSQRLVDVCNANDADLELTPIG
ATNIITRTRDLHDEGTNVPIAGEGNGGVFFPPYRLSRDGAYIGARFLELLAAASDPVSEV
VAPYADYHFVRRNVEYADDDERDEMLSAARAYVETADAEPNTTDGYRLDYGDAWVLVRPS
GTEPKIRIYAESADADRAERLATDMYVAVESGR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagctgttcggatctagcggcattcgcggggtcgcgctccggtatctcacgccggaa
ctcgtcctcggaatcgcgaaggccgccggcacgacctgggacgccgaccgggtcgccgtc
gcccgcgacacccgtaccaccggcgagctgttcgccaacgccgctgcgagcgggctggcc
gcggtcggctgcgacgtcgaccggctcggcgtcgtcccgacgccagcggtcggcaactac
tgcgagtcggccggcattccctgtgtcctcgtcacggcctcgcacaacccgccggagttc
aacgggatcaagctcgtcggcgacgacggcgtggagctgtcggtcgacgtgctcgaacgc
gtcgaacgtcgcgtcctcgacgacgagtacgaccacgccgactggcggaacgcgggcgct
acaacccgcgtcgagtgcgccgtcgacgactacgtcgaccagctgctcgacgcggtcgac
cgcgaggcgatcgccgacgcgaacctcacggtcgcggtcgaccccggccacggcgcggcg
tcagtgtcgtcgccgcggatctaccgagagctcggctgtgaggtgctgaccgtgaacgcg
acaccggacggtcacttccccggccgggattcggagccggtcccggagaacctcgacgac
cttcaacggctcgtcgcgaccaccgacgccgacgtggggatcgcccacgacggcgacgcg
gaccgagcggtgttcgtcgacgagaacggggagttcgtcgacggtgacacctcgttcgca
gtgatggcagacgcctgcctcgaacccggtgatgccgtcgtcagcgcggtgaacgtctcc
cagcggctcgtcgatgtctgcaacgccaacgatgctgacttggagctgacccccatcgga
gcgacgaacatcatcacgcgaacgcgcgacctccacgacgaggggacgaacgtccccatc
gccggcgaagggaacggcggggtgttcttcccgccgtatcggctctcgcgcgacggtgcg
tacatcggcgcgcgcttccttgagctgctcgcggccgccagcgacccggtcagcgaggtg
gttgccccctacgccgactaccacttcgtgcggcgcaacgtcgagtacgcggacgacgac
gagcgcgacgagatgctgtcagccgcgcgagcttacgttgagaccgcggacgcggagccg
aacaccaccgacggctaccgtctcgactacggggacgcgtgggtgctcgtgcgcccctcc
ggcaccgaaccgaagatccggatctacgccgagtccgccgacgccgaccgcgccgagcgg
ctggcgacagacatgtacgtcgcagtcgagagcggacggtag

DBGET integrated database retrieval system