KEGG   Halorubrum lacusprofundi: Hlac_2478Help
Entry
Hlac_2478         CDS       T00856                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00340  Histidine metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01230  Biosynthesis of amino acids
Module
hla_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Hlac_2478
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Hlac_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACM58051
UniProt: B9LT79
Position
1:2455413..2456690
Genome map
AA seq 425 aa AA seqDB search
MDVRTVADLSPAERLAFFERDAGVDAVRDDVSEIVDRVRTEGDVALREFSEEFDGVAVGN
IDITDDAERAHAEFDDANDPVLDAVRDAAANIREFHERQHPEDWRDEFGDRELGRRFRPI
DRAGVYVPGGAAAYPSSALMGVIPAAVAGVDHVSVATPPAEEINPVTLAAIHEAGADAVY
QVGGAQAIAALAYGTETVTNAQKVVGPGNKWVTAAKAIVQGDVEIDFLAGPSEVLVLADE
TADPDLVASDLIAQAEHDPNASVVAVTDDAALAEAVAEAVDEQVAGRKREETIRAALDND
ASGVLHARSMPEAVLFTEEYAAEHLSIAADDDEALLARISNAGSVFLGAYSPVAAGDYAT
GTNHVLPTNGGAKRYGGLSVDTFLRSSTVQRLDRDALDGLSETITTLAEAEGLEAHAESV
RKRFE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacgaaccgtcgctgacctctcgccggccgagcgcctcgccttcttcgagcgc
gacgccggcgtcgacgcggtccgcgacgacgtgagcgagatcgtcgatcgagtccggacg
gagggcgacgtcgcgctccgagagttctccgaggagttcgacggcgtggccgtcggcaac
atcgacatcaccgacgacgccgagcgcgcccacgccgaattcgacgacgcaaacgatccg
gtcctcgacgcggtccgcgacgcggccgccaacatccgcgagttccacgagcgacagcac
cccgaggactggcgcgatgagttcggcgaccgcgaactcggccgccggttccgcccgatc
gaccgcgccggggtgtacgtgcccggcggcgcggcggcgtacccctccagcgcactgatg
ggcgtgatcccggcggcagtggcgggcgtcgaccacgtctcggtcgcgacgccgccggcc
gaggagatcaaccccgtcacgctcgcggcgatccacgaggccggcgccgacgcggtgtat
caggtcggcggcgcgcaggcgatcgccgcgctcgcgtacggcacggagaccgtcacgaac
gcccagaaggtggtcgggcccggcaataagtgggtcaccgccgcgaaggcgatcgtgcag
ggcgacgtggagatcgacttcctcgccgggccgagcgaggtgctcgtcctcgccgacgag
accgccgaccccgacctcgtcgcgagcgacctgatcgcgcaggccgaacacgacccgaac
gcctccgtggtcgccgtcaccgacgacgccgccctcgccgaggcggtcgcagaggcggtc
gacgagcaggtcgcgggccgtaaacgcgaggagacgatacgagccgccctcgacaacgac
gcctccggggtccttcacgccagatcgatgcccgaggcggtgttgttcaccgaggagtac
gcggccgaacacctctcgatcgcggccgacgacgacgaggcgctgctcgcccggatctcg
aacgctggctcggtgttcctcggggcgtactcccccgtcgccgccggcgactacgcaacc
gggacgaaccacgtgctgccgacgaacggcggcgcaaagcgctacggcgggctctccgtc
gacaccttcctccggtcgtcgacggttcagcgactcgaccgcgacgcgctcgacgggctc
tcagagacgatcacgacgctcgcggaggccgaggggctggaggcgcacgccgagagcgtt
cggaagaggttcgagtag

DBGET integrated database retrieval system