KEGG   Halorubrum lacusprofundi: Hlac_3047Help
Entry
Hlac_3047         CDS       T00856                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00010  Glycolysis / Gluconeogenesis
hla00053  Ascorbate and aldarate metabolism
hla00071  Fatty acid degradation
hla00280  Valine, leucine and isoleucine degradation
hla00310  Lysine degradation
hla00330  Arginine and proline metabolism
hla00340  Histidine metabolism
hla00380  Tryptophan metabolism
hla00410  beta-Alanine metabolism
hla00561  Glycerolipid metabolism
hla00620  Pyruvate metabolism
hla00625  Chloroalkane and chloroalkene degradation
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_3047
   00053 Ascorbate and aldarate metabolism
    Hlac_3047
   00620 Pyruvate metabolism
    Hlac_3047
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hlac_3047
   00561 Glycerolipid metabolism
    Hlac_3047
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hlac_3047
   00310 Lysine degradation
    Hlac_3047
   00330 Arginine and proline metabolism
    Hlac_3047
   00340 Histidine metabolism
    Hlac_3047
   00380 Tryptophan metabolism
    Hlac_3047
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hlac_3047
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hlac_3047
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Hlac_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ACM58590
UniProt: B9LV77
Position
2:complement(305758..307284)
Genome map
AA seq 508 aa AA seqDB search
MSVDDQSQTPSERKSAIKKRHEQAASEVLPDHRELYIGGEWVQSASGETFTTVDPTTGET
LAEVEAGNGEDIDRAVDAAWEAYDEVYSSYSSAERQAMLEAIADRIENNADEFARLESLD
NGKPITEARIDIELVVDHFRYFAGIARAHEGRTVDTDDSRHVQTIEEPYGVVGQIIPWNF
PLLMAAWKLGPALSAGNTVVLKPAEETPLSVLKLMEEADDVIPDGVVNIVTGFGPDAGEP
LSNHSGIRKLAFTGSTEIGSKVMKSAADNITDITLELGGKSPLVVFPDADLEQAVQTTIT
AIFFNTGECCCAGSRLFVHEDIKDEFLDELAAAAEDLTVDDPLLDATDLGPKVTAEQVER
TMSYIEEAEQSGAAFVTGGSQPDDEALSDGCFVAPTLIDNIDHDSKAVQEEIFGPVQEVF
SWSDYDEMIELANDVDYGLAAGVITENLTKAHQCAKDIEAGNIWINTYNDFPAGQPFGGY
KQSGIGREIGQDAVDHYTQTKTINISLS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgatgaccaatcacagacaccatcggagcgtaaatccgcgattaaaaagcgt
cacgagcaggccgcaagcgaggtgctacccgaccatcgagaactctacatcggcggtgag
tgggtccagagtgcctccggcgagacgttcacaacagtcgacccgacaaccggtgagaca
ctcgccgaggtagaggcaggcaacggcgaggacatcgaccgcgcggtcgacgcggcctgg
gaggcctacgatgaggtgtacagctcctattcgagtgccgaacgacaggcgatgctcgaa
gcgattgccgaccgtatcgagaacaacgcagacgagttcgcccgactggagtccctcgac
aatgggaaaccaattaccgaggcccgcatcgatatcgaactcgtcgtcgaccacttccgc
tatttcgcgggcatcgctcgggcccacgagggacggacggtcgacactgacgacagtcga
cacgtccaaaccatcgaagaaccctacggcgtcgtcggccaaattattccgtggaatttc
ccgcttttaatggctgcctggaaactcggccctgcgctgtcggctggcaacacagtcgtc
ctcaaaccggccgaggaaacacccctttccgttctcaaactgatggaggaggccgacgac
gtgatcccagacggtgtcgtcaacatcgtcaccgggttcggtcccgatgctggcgaaccg
ctttcgaaccacagcggcatccggaaactcgcctttaccgggtcgaccgaaatcggcagc
aaggtgatgaaaagcgccgccgacaacatcaccgacatcacgctcgaactgggtggcaaa
agcccgctcgtcgtgttccccgatgcggacttagagcaggcagtccagaccacgatcacc
gccatcttcttcaataccggcgagtgctgctgtgcgggttcacgactctttgtccacgaa
gacatcaaagatgagttcctcgacgaactcgcggcggccgccgaagatctgaccgtcgac
gatccactgctggatgcgactgatctcggcccgaaggtgaccgctgaacaggtcgaacga
accatgagctacatcgaagaggccgaacagtccggggcggcctttgtcaccggcggcagc
cagcccgacgacgaagccctgtcggacggctgtttcgttgcgccaacactgatcgataac
atcgatcacgacagtaaggccgtccaagaggagattttcggccccgtccaagaggtgttc
tcgtggagcgactacgacgagatgatcgagttggcgaacgatgtcgactacgggctcgca
gctggcgtgatcaccgagaacctcacgaaggcccaccagtgtgccaaagacatcgaggcc
ggcaacatctggatcaacacgtacaacgacttcccagctggccagccgttcggcggctac
aagcaatcaggaatcggccgtgaaatcggtcaagacgccgtcgaccactacactcagacc
aagacgatcaacatcagtctcagctaa

DBGET integrated database retrieval system