KEGG   Halorubrum lacusprofundi: Hlac_3373Help
Entry
Hlac_3373         CDS       T00856                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00250  Alanine, aspartate and glutamate metabolism
hla00330  Arginine and proline metabolism
hla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hlac_3373
   00330 Arginine and proline metabolism
    Hlac_3373
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Hlac_3373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACM58891
UniProt: B9LWQ0
Position
pHLAC01:126560..128158
Genome map
AA seq 532 aa AA seqDB search
MTLSQFENELTIHEHTQAGTLDEFHRAYEAEVDDIRSDFGATHPLRIDGDAVETGETFTV
TNPGDTDQVLGEFAAGDETHVDEAVAAASDAFDEWKETSWEERVAIFRDAADVIQDRKLE
ITALMAYENAKTRNEAIAEVDEAIDFLRYYSSELERNEGYTADTHEPTPGQRCVSDLQPY
GVFGVVAPFNFPFAITVGMTTGALITGNTAVVKPASTTPLTAHAFYDALAEAGIPDGVVN
LVTGGGRAVGQPMIEHEDVAGFVFTGSREVGLEIQRTFDELGKRGPVVAELGGKNPVIVS
DSADVSKAVSGVKFGAFSFSGQKCSATSRVYVHEDIADEFTEQLVEETNDLSIGKPENRE
TVVSPLIDDSAIERYDDICETAAADGTVLTGGSRIDRENLPTGRYVEPTVVTDIPHDHAL
ATDEHFLPFVTIHPVSSLEEGITKANDSDYGLCAGLFSEDEDEIDTWFDRIESGMCYVNR
EQSATTGALVEAQPFGGWKYSGTTGKFAGGPWYLQQFMRQQSRTVVGDVGQP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacactcagtcaattcgagaacgaacttacgattcacgagcacacgcaggcggggacg
ctggacgagtttcaccgtgcctacgaggccgaagtcgacgacatccgctccgatttcggg
gcgactcaccctctccggatcgacggcgacgcggtcgagaccggagagacattcaccgtc
acgaatccgggagacacggaccaggtcctcggggagttcgcagcgggagatgagacgcac
gtcgacgaggccgtcgcggccgcgagcgacgccttcgacgagtggaaggagacgtcctgg
gaggagcgcgtcgcgatatttcgcgacgccgcggacgtcatccaggaccgcaaactcgag
atcacagcgttgatggcctacgaaaatgcaaaaacacggaacgaggcgattgcggaggtc
gacgaggcgatcgacttcctccggtactacagcagtgaactggaacggaacgagggatac
accgccgacacacatgagccaacacctggccagcgctgcgtcagcgacctccagccgtac
ggcgtcttcggcgttgtggccccgttcaattttccgttcgcgatcaccgtcggaatgaca
accggcgcgctgatcaccggaaacaccgcagtcgtgaagccggcgagcaccacgccgctg
acggcgcacgcgttctacgacgccctcgcggaggcgggcattccggacggcgtcgtcaac
ctggtcacgggtggcgggcgggcggtcggtcaaccgatgatcgaacacgaggacgtcgcc
ggattcgtgtttacgggctctcgcgaggtcggactcgagatccagcggaccttcgacgag
ctgggcaaacgcgggccagtcgtcgcggagctcggcgggaagaacccggtcatcgtctcc
gacagcgccgatgtctcgaaggccgtctctggcgtgaagtttggtgcgttttcgttcagc
ggtcagaagtgctctgcgacctcccgcgtatacgtccacgaggacatcgccgacgagttc
acggagcaactcgtcgaggagacgaacgacctctccatcggcaagcccgagaaccgggag
acggtcgtctctcccctgatcgacgacagcgcgatcgagcgctacgacgatatctgtgaa
acggcggccgcggacggcacggtcctgaccggcgggagccgcatcgaccgagaaaacctc
ccgaccggccggtacgtcgagccgaccgtggtcacggacattccgcacgatcacgcgctc
gcgacggacgagcacttcctcccgttcgttactatccaccccgtctcgagcctcgaggaa
gggattacgaaggccaacgacagcgattacggactctgtgctggcctcttctccgaggac
gaggacgagatcgacacgtggttcgaccggatcgagtccgggatgtgctacgtgaaccgc
gagcagagcgcgacgaccggtgcgctcgtcgaggcccaaccgttcggcggctggaagtac
tccgggacgaccgggaaattcgcgggcggtccgtggtacctccagcagttcatgcgtcag
cagagtcggactgtggtcggcgacgtcggacagccctga

DBGET integrated database retrieval system