KEGG   Halorubrum lacusprofundi: Hlac_3462Help
Entry
Hlac_3462         CDS       T00856                                 

Definition
(GenBank) magnesium chelatase ChlI subunit
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00860  Porphyrin and chlorophyll metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hlac_3462
Enzymes [BR:hla01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Hlac_3462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 VWA MCM AAA_16 VWA_3 Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: ACM58972
UniProt: B9LWY1
Position
pHLAC01:211681..213945
Genome map
AA seq 754 aa AA seqDB search
MVDFGSHKKPSHAGRQRPRFDDVVGQHALKEALLAVATDDDLDGLLVQGEKGTAKSTTVQ
GLADLLPDQRVVADCDFGCHPEDASLQCVDCRDRENPPTAMRPVPLVTLPLGATRERIVG
TLSVADALDGDHEFDPGLLARAHRGVLYVDEVNLLDDHLVDVLLSAAASGVNRVERDGIS
VTHPAEFTLVGTMNPEEGDLRPQLRDRFALQTTVTGCSDLDDRVEIIDQALDEATETPDS
TSTGRDSGERLRDARDRIGDVVLERSLREDIAELCRDAGVDGHRGDIATARTARALAALD
GRDRVEENDVETAARFALPHRLRAQPFEDAPDVEEVVDEHFDDEGGAEDGESDAEDGEGD
AEDGERRAENGDDESGDADAGDAGGDDERDASGTGDREGGAGDAGDGALDDEGKAGDATA
AGDDESADDTEGDSDRPADEGDDEPRDASPRPSPGRGARSDDDSSANEQPRANPEGDAAE
GGTPLLPGQDRADVGEAAAPELSPPEAIAEPGSGTGSRASASPSVDANGSRVRTERTDAG
TGGVSVDAAASVRAASARGASSVESRDLRQSVRAGDSSALVLFVVDASASMRPAMRAAKG
TVLELLEDAYQHRDAVGFVAFAGTDAEVLLPPTDSVTLAARHLKSLPTGDRTPLPAGLRT
AGRVLDRADPAASVVVVVTDGRANVADGSPVAETRAAGRGLAERDAHVVVVAAGEDDGPT
VTDALVEASGGERVPLAALSAARVDESVREVRDQ
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggttgatttcggtagtcacaaaaaaccctcgcacgccggccgccagcggccgaggttc
gacgacgtcgtcggccagcacgccctcaaggaggcgttgctggcggtcgcgaccgacgac
gacctcgacggcctcctcgtgcagggcgagaagggaacggcgaagtccaccaccgtccag
gggctcgccgacctcctccccgaccagcgcgtcgtcgccgactgcgacttcggctgtcac
ccggaggacgcctcgctccagtgcgtcgactgtcgcgaccgtgagaacccgccgacagcg
atgcgaccagtgccgctcgtcacgctcccgctcggtgcgacgagagaacggatcgtcggc
acgctgtccgtcgcggacgcactcgacggcgaccacgagttcgaccccggcctgctcgca
cgcgcccaccgcggggtcctctacgtcgacgaggtgaacctgctcgacgaccacctcgtc
gacgtcctgctctccgccgccgccagcggcgtcaatcgcgtcgagcgcgacggcatcagc
gtcacgcaccccgcggagttcacgctcgtcgggacgatgaaccccgaagaaggcgacctc
cggccccagctccgcgaccggttcgcgctccagacgacggtcacgggctgttcggacctc
gacgaccgcgtcgagatcatcgaccaggcgctggacgaggccaccgaaaccccggattcg
acgtccaccggacgcgactccggcgagcgcctgcgcgatgccagggaccgcatcggcgac
gtcgtactcgaacgctccctccgcgaggacatcgcggaactctgccgggacgccggcgtc
gacggtcatcgcggcgacatcgcgacagcgcggaccgcacgagcgctcgccgcactcgac
ggccgcgaccgcgtcgaggagaacgacgtcgagaccgcggcacgcttcgcgctcccgcat
cgactccgggcacaaccgttcgaggacgcccccgacgtagaggaggtcgtcgacgaacac
ttcgacgacgaaggtggcgcagaggacggcgagagcgacgccgaggacggcgagggtgac
gccgaagacggcgaacgccgggccgagaacggagatgacgagtccggtgacgccgatgcc
ggcgacgctggtggggacgacgaacgcgacgcctccggcacaggggacagggaaggaggc
gctggtgatgccggcgatggggctctcgacgacgaggggaaggccggggacgcgaccgcc
gcaggcgacgacgaatcggcggacgataccgaaggcgacagcgaccgccccgccgacgag
ggtgacgacgagccacgcgatgcgagtccgcggccgagtccgggccgtggcgcccgcagt
gacgacgattcgagcgcgaacgaacagccccgagcgaatcccgaaggtgatgcggccgag
ggagggacgccgttgctacccggccaggaccgcgcggacgtcggggaggcggcggcgccg
gagctgtcgccaccggaggcgatagccgaacctgggtccgggaccgggtcgcgtgcgtcg
gcgtcgccgagcgtggacgcgaacggttctcgtgtacggacggagcggacggacgctgga
actggcggtgtgagtgtggacgcggcggcgtcggtgcgtgcggcgagcgcgcgcggtgcg
tcgtccgtcgaatcgcgggatctccggcagtcggttcgcgccggtgattcgtcggcgctc
gtgttgttcgtcgtggacgcgagcgcgtcgatgcggccggcgatgcgtgcggcgaagggg
accgtgctggaactgctggaggacgcctaccagcaccgggacgcggtcgggttcgtggcg
ttcgcgggcacggatgcggaggtgctcctgccgccgactgacagcgtgacgctcgccgct
cggcatctgaagtcgctcccgactggggaccggacgccgcttccggcgggtttgcggacc
gcggggcgcgtgcttgatcgtgcggacccggcggcgagcgtggtcgtggtggtgacggac
ggacgcgcgaacgtcgcggacggcagtccggtcgcggagacgcgcgccgcgggccgtgga
ttggccgagcgcgacgcgcacgtcgtcgtcgtcgccgccggtgaggacgacgggccgacg
gtcacggacgcgctggtcgaggcgagcggtggggagcgcgtcccgctcgccgccctcagc
gcggcgcgcgtcgacgagtccgtgcgagaggttcgggaccagtaa

DBGET integrated database retrieval system