KEGG   Halobiforma lacisalsi: CHINAEXTREME16305Help
Entry
CHINAEXTREME16305 CDS       T04669                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
hlc  Halobiforma lacisalsi
Pathway
hlc00670  One carbon pool by folate
hlc00790  Folate biosynthesis
hlc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hlc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHINAEXTREME16305
   00670 One carbon pool by folate
    CHINAEXTREME16305
Enzymes [BR:hlc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CHINAEXTREME16305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: APW99236
UniProt: M0LFN9
Position
3358056..3358619
Genome map
AA seq 187 aa AA seqDB search
MAGEPNSETISALEAAEATDRELVGIVAVADNGVIGADGEMPWHLPADLAHFKETTMDHP
VIMGRVTYEGILETLGDPLPGRTTVVLTSQDLETPENAVVANGLTEAVERADRAARERHD
GADRIFVAGGATVYEGFLPVLDRLVVTEIHDDPEGDAYFPAIDPEDWIEADRDERDGFAF
VEYVRRD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggccggggagccgaattcggagacgatttccgcactcgaggccgccgaggccaccgac
cgcgaactcgtcggcatcgtcgccgtcgccgacaacggcgttatcggggccgacggcgag
atgccatggcacctcccggcggacctcgcccacttcaaggagaccacgatggaccacccc
gtgatcatgggtcgggttacctacgaggggatcctcgagacgctgggcgacccgctcccg
ggacgaacgaccgtcgtcctgacgagccaggacctcgagacgcccgagaacgccgtcgtc
gcgaacgggctcacagaggccgtcgaacgggccgaccgcgcggcccgggagcgccacgac
ggggcggatcggatcttcgtggccgggggtgcaacggtgtacgaggggttcctgcccgtg
ctggatcggctggtcgtcacggagatccacgacgaccccgagggcgacgcctacttcccc
gcgatcgatcccgaagactggatcgaagccgaccgcgacgagcgtgacggcttcgcgttc
gtcgagtacgtccggcgggactga

DBGET integrated database retrieval system