KEGG   Halobacillus litoralis: HLI_00800Help
Entry
HLI_00800         CDS       T05828                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
hli  Halobacillus litoralis
Pathway
hli00670  One carbon pool by folate
hli00790  Folate biosynthesis
hli01100  Metabolic pathways
Module
hli_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HLI_00800
   00670 One carbon pool by folate
    HLI_00800
Enzymes [BR:hli01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HLI_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: QAS50838
UniProt: A0A410M799
Position
143321..143815
Genome map
AA seq 164 aa AA seqDB search
MISFIFAMDRNRLIGKDNDLPWHIPNDFKFFKDMTWGKTIIMGRKTFESFGKPLPEREHI
VITHNDDYDREGCTVIHSIDEIVQLERDEPEREWFVIGGSVLFEKMLPYADRMYLTLIDD
EFEGDTYFPGYNEAEWELISETKGKKDEKNPYDYYFRTYDRKTS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttttatttttgcaatggaccgaaaccgtttgatcgggaaggataacgatctc
ccatggcatatcccgaatgattttaagttcttcaaggatatgacttggggcaagacaatc
atcatgggaagaaaaacatttgaatctttcggaaagccgctgccagagcgtgaacatatt
gtcattactcataatgatgattatgaccgtgaaggctgcacagtgattcattctattgat
gaaattgtgcagttggaaagggacgagccggaaagagaatggttcgtcatcggaggcagc
gtactttttgagaaaatgcttccttatgccgaccggatgtatttaactttgatcgatgat
gagtttgaaggggatacgtacttcccggggtacaatgaagcagagtgggaactcatctca
gaaacaaaagggaagaaagacgagaagaacccatacgattactatttcagaacctatgac
aggaagacttcttga

DBGET integrated database retrieval system