KEGG   Halobacillus litoralis: HLI_02100Help
Entry
HLI_02100         CDS       T05828                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
hli  Halobacillus litoralis
Brite
KEGG Orthology (KO) [BR:hli00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hli03009]
    HLI_02100
Enzymes [BR:hli01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     HLI_02100
Ribosome biogenesis [BR:hli03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HLI_02100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: QAS51077
UniProt: A0A410M8N8
Position
complement(407348..408259)
Genome map
AA seq 303 aa AA seqDB search
MSEKYVVTENDQSKRIDKLLTEVIPDSSRSQIQGWLKDHVVLVDGKPVKSNYKVQPDDTI
TWAVPEPEPMDILPEKVDLHIVYEDEDVIVVNKPSGMVIHPSAGHHSGTLVNALLYHCTD
LSGINGVERPGIVHRIDKDTSGLIMVAKNDRAHKSLAEQLSKKTVERKYEAIVHGEIHHE
YGTIEAPIGRDTKDRQKMAVVDGGRDAVTHFRVLRHFTDFTLVECTLETGRTHQIRVHMR
YISHPLAGDPKYGPRKTLDLNGQALHAKSLGFEHPRTGEWKKFEVEPPQDFKETLSYLET
KEL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgaaaaatatgtggtaacagaaaacgatcaatccaaacgaattgataaacttttg
actgaagtcattccagattcatccaggtcccaaatccaaggctggttgaaagatcatgtc
gtccttgtagatgggaaacctgtgaaaagtaattataaagtccagccagatgatacgatc
acctgggctgtacctgaaccggagccaatggatattctccctgagaaagtcgatcttcat
atcgtgtatgaagatgaagacgtcattgtcgtcaataagccgtccgggatggtgatccac
ccgtctgcagggcatcattcaggaacacttgtaaatgctttgctttatcattgtacagac
ctttcaggaatcaatggagttgaacgtcccgggatcgtgcatcggattgataaagacacg
agtggtcttatcatggtggcaaaaaatgaccgtgcccacaaatctttggctgaacaactt
tcaaagaaaacagtggagcggaaatacgaagccatcgtgcatggggaaatccatcacgaa
tatggtaccatcgaagccccgatcggacgtgacacgaaagatcgccagaaaatggcggtg
gtggatggagggagagatgcagttacacatttcagggtactgcgtcacttcacagacttt
acgttggtagaatgtactcttgaaacaggaaggactcaccaaatacgggtccatatgcgc
tatatcagtcatccgcttgcgggtgatcctaaatatggtccgcgaaaaacattggatctg
aacggacaggcgctccatgccaaatctcttggttttgaacacccgagaacgggcgagtgg
aagaaattcgaagtcgaaccaccgcaggacttcaaagaaacgctctcctatttagaaaca
aaagaattgtaa

DBGET integrated database retrieval system