KEGG   Halobacillus litoralis: HLI_13065Help
Entry
HLI_13065         CDS       T05828                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
hli  Halobacillus litoralis
Pathway
hli00561  Glycerolipid metabolism
hli00640  Propanoate metabolism
hli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HLI_13065
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    HLI_13065
Enzymes [BR:hli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     HLI_13065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase PFK DegS DUF5365
Motif
Other DBs
NCBI-ProteinID: QAS53053
UniProt: A0A410MEA8
Position
complement(2534021..2535136)
Genome map
AA seq 371 aa AA seqDB search
MKERVYISPAKYVQGRNAVRKIGHHLEGIGETAVVISDETVWKIAGDDVVSYLNEANITT
KNVVFNGEASPTEMDRIADIAKETEASIVIGVGGGKTLDTAKAVSDEVQGYTVIIPTTAS
TDAPTSALSVVYSDEGVFESYRFYDKNPDLVLLDSKIIAEAPPRFLASGIADALATFVEV
KSVVNNSGNTMAGGQTTLAAQAIAEKCEEVLFDYALLAYQSNERGVVTSALENVIEANTL
LSGLGFESGGLGAAHAIHNGFTALEGDIHHLTHGEKVAFGTLVQLTMEEHSQEVMEQYMA
LYTSLDLPITLEDIKLKDVSKEDILKVAETATADGETIHQAFSVTAEEVADAIIATDQYA
KTFKGMLQLGE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacgtgtatatataagcccggcaaaatatgtccaaggcagaaacgctgtccgt
aagattggacaccatttagaaggtattggtgagactgctgttgtcatttcagacgaaacc
gtatggaaaattgcaggcgatgatgtcgtatcttatctgaacgaagcaaacatcactacg
aagaatgtggtattcaatggcgaagcttctccaacagaaatggatcgaatcgctgatata
gcaaaagagacagaagcttccattgtcattggtgttgggggaggaaaaacgctggatact
gcaaaagcggtttctgatgaagttcaaggttacacggtaatcattccaacaacggcttct
acagacgcacctaccagcgcgctttccgttgtttattcagatgaaggcgtttttgaatcc
taccgtttctatgacaagaatccagatcttgtattgctggattccaaaatcattgcagaa
gctcctccgcggttcttagcttccggtattgccgatgcactcgctacattcgtagaggtg
aaaagtgttgtgaacaatagcggtaatacgatggcaggaggacaaacaacactcgctgca
caggcgatagcagaaaaatgtgaagaagtactattcgattatgcattactcgcttatcaa
tcgaacgaacgaggagtagtaacgtctgctcttgaaaatgtgattgaagcaaacactctt
ctcagcggtctaggctttgaaagtggcggactaggtgctgcccacgctattcataatggt
ttcaccgcgctggaaggcgacatccaccacctcacacacggagagaaagtagctttcggc
acccttgttcaattaacaatggaagaacattctcaagaagtaatggaacaatatatggca
ttatataccagccttgacctaccaatcaccttggaagatatcaaactgaaagatgtctcc
aaagaagatattctcaaagtagccgaaacagcaacagccgacggagaaactatccaccag
gctttttcagtaactgctgaagaagtggctgatgcgattattgctaccgatcaatatgcc
aaaactttcaaaggtatgctgcagttgggtgaataa

DBGET integrated database retrieval system