KEGG   Halobellus limi: DV707_09850Help
Entry
DV707_09850       CDS       T05944                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
hlm  Halobellus limi
Pathway
hlm00361  Chlorocyclohexane and chlorobenzene degradation
hlm00625  Chloroalkane and chloroalkene degradation
hlm01100  Metabolic pathways
hlm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hlm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DV707_09850
   00361 Chlorocyclohexane and chlorobenzene degradation
    DV707_09850
Enzymes [BR:hlm01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     DV707_09850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: QCC47938
UniProt: A0A1H5ZTE5
Position
complement(2019156..2019839)
Genome map
AA seq 227 aa AA seqDB search
MTFDPDRVRTVTFDSYSTLVDVDAAEKALADRVAAPEPVSKLWRSRSIEYTFVANHVDAY
QPFYEMNRDALQYALDAHDEGISTDERDEILAVYHELDVFDDVRDGIERLRSGGYDCYVV
SNGNPEMLASMVEHAGIGDLIEDAISAEEVRTFKPDAEIYRHAAGRTGTPIGEIAHVTAG
WFDVMGAKHAGMQGVWVDRKGTPWESFDGEPDLTVESFHELADALDV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgacccagaccgcgtgaggacggtcacgttcgactcctacagcacgctcgtc
gacgtggacgcggccgagaaggcgctggccgaccgcgtcgccgcgcccgagcccgtctcg
aagctctggcgctcgcgatcgatcgagtacacgttcgtcgccaaccacgtcgacgcctac
cagccgttctacgagatgaaccgcgacgcgctccagtacgcgctggacgcccacgacgag
gggatctcgacggacgagcgcgacgagatcctggcggtgtaccacgaactcgacgtcttc
gacgacgtccgcgacggcatcgaacggctccgctcgggcgggtacgactgctacgtcgtc
tcgaacggcaaccccgagatgctggcgtcgatggtcgaacacgccgggatcggcgacctg
atcgaagacgcgatcagcgccgaggaggtccggaccttcaaacccgacgccgagatctac
cgccacgccgccggacggacggggacgccgatcggggagatcgcccacgtcacggcgggt
tggttcgacgtgatgggcgcgaagcacgccgggatgcagggcgtctgggtcgaccgcaag
gggacgccgtgggagtccttcgacggcgaaccggatctcacagtcgagtcgttccacgaa
ctggcagacgccctggacgtctga

DBGET integrated database retrieval system