KEGG   Halostagnicola larsenii: HALLA_01855Help
Entry
HALLA_01855       CDS       T03008                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
hlr  Halostagnicola larsenii
Pathway
hlr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HALLA_01855
Enzymes [BR:hlr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HALLA_01855
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HALLA_01855
    1.1.1.-  
     HALLA_01855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AHG02073
UniProt: W0JYJ0
Position
unnamed2:382029..383012
Genome map
AA seq 327 aa AA seqDB search
MDEPTPEAGEILVDVAACGICGSDLHFYTEGLHGDAELPVTLGHEVGGTVIQTGDGVDIE
EGTDVVLSPHTPCMECWCCKDGLYNLCTNLNATSAKPGGYAEKVVESADNAITLPDGVSP
EDAAIAQPVSVGLHAVRESPLGIGDSTLVVGAGPIGLGVVRFAKSTGAGPIFVSEPQESR
QEVALELGADVVIDPTEEDPVERVHEETGTGVDVAFEAVGHQETFNQAIESTRANGHTTV
IGVFSGEAEISPQSLVSHQRSISGSTSHQLGPRVTKEYNAVLRQLESGELDADRYVTSRI
GLEDVVEDGFETLLEADNEERKILVCP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaaccaacgcccgaagcgggtgagatcctggtagacgtcgcagcgtgtgggatc
tgcgggtccgatcttcacttctacacggaggggctccacggagacgcggagctacctgtt
acgctcggccacgaggtcggcggaacagtcatccagaccggagacggtgtggatatcgag
gaggggacggacgttgtactcagcccacacactccgtgtatggagtgttggtgctgtaaa
gacggcctatacaatctctgtaccaacctgaacgcgacctccgcaaaaccgggcgggtac
gcggagaaagtagtcgaaagcgcagataacgcgattacacttccggacggcgtttctccg
gaggatgcggcgatcgcccagccagtaagcgtcggccttcacgccgtccgcgagtcgcca
ctcgggatcggagacagtacgctggtggtgggcgcgggaccgatcgggttgggcgtcgtt
cgatttgcgaagtcgaccggagcggggccgattttcgtctcggagccccaggaatcccga
caggaggtcgcgctggaactcggggccgacgtagtgatcgatccaaccgaggaggaccca
gtcgagcgcgtccacgaggagaccggcaccggtgtcgacgtcgcgttcgaagccgtcggt
catcaggagacgttcaatcaggcgatcgaatcgacgcgagccaacggtcacaccacggtg
atcggcgtattcagcggtgaggctgaaatatccccacaaagtctcgtgagtcaccagcgg
tcgatttccggatcgacgtcccatcagttggggccccgagtgaccaaggagtacaacgca
gtacttcgccagctcgaaagcggcgaactcgacgccgatcggtacgtcacctcgcggatc
gggctcgaggatgtcgtcgaggacggattcgaaaccctcctcgaggcggacaacgaagaa
cgtaaaattctcgtctgcccctga

DBGET integrated database retrieval system