KEGG   Haloarcula marismortui: pNG5033Help
Entry
pNG5033           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymopoietin
Motif
Other DBs
NCBI-ProteinID: AAV44455
UniProt: Q5V7I6
Position
pNG500:complement(30110..30607)
Genome map
AA seq 165 aa AA seqDB search
MRSFQRHEATQRPRLGICRGPGKLYRPRKQHRRCGGGRMLKRLLSNDDEPEPPAVSVPFD
ALLDIAQSERRRQCLRTVNEHGRLELTDLAEIVAAAEVGTDRDQLQSQQRKRVYVSLYQT
HIAKLDNTGLVRWSQTNGTVCATAETGPAVGALNDLADRTTGGDC
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcgttccagcgccatgaagcaacccaacgaccgcgcctcggtatttgccgaggc
cccggaaaactgtatcgacccagaaagcagcaccgtcgctgcgggggtggccggatgctg
aaacgcctactctctaacgacgacgagccggagccaccggcagtgagcgtcccgttcgac
gccctgctggatatcgcccagtctgaacgccgacgccagtgcctccggacggtgaacgaa
cacggccgactggaactcaccgatctggcggagatcgtcgccgctgcggaagtcggcact
gaccgcgaccagctccagtcccaacagcgcaagcgtgtgtacgtgtctctgtatcagacg
cacattgcgaaactggacaacaccggactggtccgctggtcccaaaccaacggcacggtc
tgtgcgaccgccgagacggggccggccgttggcgccctgaacgacctcgccgaccggacg
acgggaggtgactgctga

DBGET integrated database retrieval system