KEGG   Haloarcula marismortui: pNG5043Help
Entry
pNG5043           CDS       T00211                                 

Gene name
tnp
Definition
(GenBank) putative ISH8 transposase
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 DDE_Tnp_1_4 DDE_Tnp_2
Motif
Other DBs
NCBI-ProteinID: AAV44464
UniProt: Q5V7J9
Position
pNG500:complement(35707..36981)
Genome map
AA seq 424 aa AA seqDB search
MRRLTTLFPSEFLEEHAEELGVVEREGKLQIPVLMWALVFGFAAGESRTLAGFRRCYNAT
ADEPISSGGFYHRLTPTLAEYLRDLVEAALDEVAVPDAVDADIDRFRDVMIADGTVLRLH
EFLSDEFQARHEEQAGAKLHLLHNATDQTIERIDVTDEKTHDSALFKTGSWLQGRLVLFD
RAYFKYRRFALIDENDGYFVSRLKQNANPVITAELREWRGRAIPLEGKQIHDVVNDLSRK
YIDVEVEAEFKRGQYEGTRSLDTKRFRVVGVRNEDADDYHLYITNLPREEFLPADLATLY
RCRWEVETLFRELKTQYELDEFDTNNPDVVKILLYAALLSLLVSRELLDLVTEQADDEIV
FPPERWAATFRSHAQLILHELGEYLGYSPPPLLERLIEDAQKIHQQRPILQETLATATQP
RCES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcggctcactacactgtttccctccgagttcctcgaagagcacgccgaggaactc
ggcgtggtcgagcgagagggcaagcttcagattcctgtcctcatgtgggcgctcgtgttc
ggcttcgccgcaggcgagagccgaacactcgctgggtttagacgctgctacaacgctaca
gctgacgaaccgatctcttctggcggtttctatcaccggttgacgcctactcttgcagag
tatctccgcgacctcgtcgaggccgcgctcgacgaggtcgctgtccctgatgctgttgac
gctgatatcgaccgattcagggacgtgatgatcgctgatggaaccgtgttgcggttgcac
gagttcctctctgatgagtttcaagcccgccacgaggagcaggctggagcgaagctccac
ctgctccacaacgccaccgaccagacgattgaacggatcgatgtgactgatgagaaaacg
cacgacagcgcgctgttcaagacgggatcgtggctgcaaggacgactggttctgtttgat
cgggcgtacttcaaataccgccgctttgcgttgatcgacgagaacgacggctactttgtg
agtcggctgaagcagaacgcaaatccggtgataacggcggaattacgggaatggcgcggc
cgcgccattcccttggagggcaagcagatccacgacgtggtcaatgatctctcgcggaag
tacatcgacgtagaggtggaagcagaattcaagcgcggccagtacgagggaactcggtcg
ctggacacgaagcggtttcgcgtcgtcggcgtccgcaacgaggacgccgacgactaccac
ctgtacatcacgaatctgccgagagaggagtttctcccggcggatctagcgacgctgtat
cggtgtcgatgggaggtagaaacgttgttccgtgagttgaaaacgcagtacgaactggac
gaattcgacacgaacaaccctgatgtcgtgaaaattctactatacgctgcgttgctgtca
ctgctggtgagccgagagttgttggatctggtcaccgagcaggccgacgatgagatcgtg
tttccgccggaacgctgggcggcgaccttccggtcgcacgcccagctcatcctccacgaa
ctcggtgagtacctcggctactcgccaccgccgttgctggagcggctgatcgaggatgct
cagaagatccaccaacaacgaccgatcttacaagagacgctcgctaccgctacacaaccg
aggtgtgagtcttag

DBGET integrated database retrieval system