KEGG   Haloarcula marismortui: pNG5052Help
Entry
pNG5052           CDS       T00211                                 

Gene name
usp8
Definition
(GenBank) universal stress protein
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp
Motif
Other DBs
NCBI-ProteinID: AAV44472
UniProt: Q5V7K5
Position
pNG500:complement(42173..42589)
Genome map
AA seq 138 aa AA seqDB search
MIETILVPVDGSAPAQEAVKYTQTVFPDANITLLTVIDPADGFAGYSGDDDGSWEKQAKA
EAESLLKDAQAEFMSPEKIRTSVVVGDPVETIIATVKNEDIDQVIMGSHGRDGIQRLLVG
SVAEQVMRKAPAPVTITR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaacaatcctcgttccggttgacggatcagcaccagcacaagaagctgtcaaa
tacactcaaactgtgttccctgatgcaaacattacgcttctgactgttatcgaccctgct
gatggattcgctggttacagtggtgatgacgatggaagctgggaaaaacaagctaaggca
gaagcagagtcactcttaaaagatgcgcaggccgaattcatgagtcccgagaaaattcga
actagcgtcgtggtcggtgacccagttgagacaattattgcaacagtcaaaaatgaagat
atagatcaagtgataatgggaagccacggtcgcgatggtattcagcggttgcttgtcggt
agcgttgcagagcaagttatgcggaaagcacctgctccggtgacaatcactcgctga

DBGET integrated database retrieval system