KEGG   Haloarcula marismortui: pNG5055Help
Entry
pNG5055           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_23 HTH_29 HTH_28 HTH_32 DUF746 HTH_31
Motif
Other DBs
NCBI-ProteinID: AAV44475
UniProt: Q5V7K9
Position
pNG500:45436..45735
Genome map
AA seq 99 aa AA seqDB search
MSGDRRKEIVRHLSEDDLNRLLSEADDPKVVRRLTFVKNLYKGDSLEEAADRVGKSESTG
SRWARRWNEGGLGQLTPNFGRTSPEARRRRAGTTLGDAP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggaccgacgcaaagagatcgtccgccatctgagtgaagatgatctcaatcgg
ttgctatcggaggcggacgatccgaaggtcgtccgccgtctcacgttcgtgaaaaatctc
tacaagggcgacagccttgaggaggcagctgaccgcgttggcaaatctgaatcgacgggt
agtcggtgggcacgtcgctggaacgaaggtggtcttggtcaattaacgccgaacttcgga
cggacgtcccccgaagctcggcgaagacgagcaggaacaactcttggagatgctccgtga

DBGET integrated database retrieval system