KEGG   Haloarcula marismortui: pNG5056Help
Entry
pNG5056           CDS       T00211                                 

Gene name
tnp
Definition
(GenBank) putative transposase
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3 HTH_33 DDE_1 rve Lipase_GDSL_3
Motif
Other DBs
NCBI-ProteinID: AAV44476
UniProt: Q5V7K8
Position
pNG500:45725..46537
Genome map
AA seq 270 aa AA seqDB search
MLRDGQPWQPQEIQHLINDEFGVEYHPVYLGEFLKDLGLSYAIPRTKRPSRPDNAEEILD
ERVSDALAEDIEEPHNKREDDDEEGWVVDEDVCTDGGTVVGFFDASHPQPYDNSRRLWYV
DDPHHERPLVKIFEPAVGFYALNGESVVSFPEDQTKERICECLERIREQNPATRILLVLD
NHFAHTCEFTRKRAHQLGIDLVFLPVGSPDLNPIEQVWKSLKWEASPLIVESANKFRSLV
SELFEQLTSRLSFAKSWIDEFLSSRLRFFS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtgacggccaaccgtggcaaccacaggaaatccagcatctcatcaacgacgag
ttcggcgttgagtaccatccagtctacctgggtgagtttctcaaggatctcggattgtca
tacgcaattccacggacaaaacgtccgtcacggccagataatgccgaagaaattctcgac
gagcgcgtcagcgacgcgctcgccgaggatattgaggaaccacacaataaacgcgaagac
gacgacgaggaaggctgggtcgtcgatgaggatgtctgcacagatggaggcactgttgtc
ggctttttcgatgcatcgcatccacagccgtacgataactcgcgccggttgtggtatgtc
gatgatccgcatcatgaacgaccgctggtgaagattttcgaaccagcggtcggcttctac
gcactcaacggtgagagtgtggtcagtttcccagaagaccagacgaaagaacggatttgt
gagtgtttagagaggatccgcgagcagaatcccgcaacgcggattctgctcgttttggat
aatcacttcgcgcacacgtgcgaattcacacgcaagcgtgcccatcaactcggaattgat
ctcgttttcttaccggttggatccccagacctcaacccaatcgagcaggtctggaagagt
ctgaaatgggaagcctctccactgattgtcgagagcgcgaacaagttccgctctctcgtc
tcagaactgttcgaacaactcacgtctcggctgagcttcgccaaatcatggatcgacgaa
ttcctcagctctcgcttgcggttcttctcctaa

DBGET integrated database retrieval system