KEGG   Haloarcula marismortui: pNG5066Help
Entry
pNG5066           CDS       T00211                                 

Definition
(GenBank) putative exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
hma  Haloarcula marismortui
Pathway
hma00511  Other glycan degradation
hma00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    pNG5066
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    pNG5066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hma02042]
    pNG5066
Enzymes [BR:hma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     pNG5066
Bacterial toxins [BR:hma02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   pNG5066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CARDB NPCBM_assoc DUF4832 TRAP_alpha Fn3-like
Motif
Other DBs
NCBI-ProteinID: AAV44485
UniProt: Q5V7L8
Position
pNG500:complement(55762..57411)
Genome map
AA seq 549 aa AA seqDB search
MTQNTLPNPPSLTTVLTAVLLVGFVVSAVPSIATAQASESGDVVGNPDVTFTTSSEPLSA
DTADELTVSIVNYGQIIQHGPSQYEDSVMTARGLSFEIDDGDTPIDVQTGQVSVGNFPTG
SIEKTVSVIVPDNAEPGTYKLPVNYEYSYTRHIRYGPSGPTEGSDSTKTKTGSITVQVRE
DARFEIVEANATTQVGDNNDVSFTLKNTGSEIARGANINAESQSSSLTFESGDTSSTASV
GDWEPGEIRTVSYNAALESDAPVRGYSVNLKINYDDIDGIDRTSDPITTTVQSIREQDFI
LSNVESQLRVGEDGDLIGTVHNDGPLPARNVVVQYTGEDQSVIPTEDSTAVGTLDPGQSE
SFSLPIAISGSAESGLRSLDMAIKYRNDEGETRTFDELAVDAEVASERDRFDATIENRTI
QAGGSRAVDVAVTNNLNEVASDVEVRLFADDPLDTGDTDTGYVQSLDPGETKTVTFELTT
TGSATVGSTYPISLDFRYDDTEGDSHLTKTYRLPIDVIESQEGGLPLPVIAVALLVIGTA
ALVIYRRQQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaacacacttcctaacccgccgtcgttaaccaccgtcctgactgccgtttta
ctcgtgggattcgttgttagtgcggtccccagtattgcaactgctcaggcatcagaatct
ggggacgttgttggaaacccagatgtcacttttacaacttcatctgagccgttatcagcc
gacaccgccgatgagctcacagtttcgattgttaattacggtcagattatccagcatggt
ccatcgcagtacgaagatagtgttatgactgctagaggactatcctttgagatagatgac
ggggatactccaattgatgtccaaactggacaggtatctgttggtaactttccaactgga
agtatagaaaagactgtctctgttatagtcccagacaatgctgaaccgggaacatataaa
ctcccagtcaattacgagtattcatatacccgccatattcgctatgggcccagtggacct
actgagggaagcgactccacaaaaacgaaaactggctcaataacagttcaggttcgggaa
gatgctcggtttgagattgttgaagcaaatgcgacaacgcaggttggcgataacaatgat
gtctcgttcacactcaagaacaccggctcagaaatcgcgagaggtgcaaatatcaatgca
gagtcacagagtagttcgctaacgttcgaatccggagatacgtcttcgacagcatctgtc
ggcgactgggaaccaggggagatccggactgtcagttataacgctgcacttgagtccgac
gctcctgtacgagggtattcagttaacttgaaaataaactacgatgatatcgatggaatt
gaccgaacatcagacccgattacgaccacggtccaatcgatccgcgagcaggatttcata
cttagtaacgtggagtcacaacttcgtgtcggtgaggacggtgacttgattggtaccgta
cacaacgacgggcccctgccggcacgcaacgtcgtggtacagtacactggggaggaccag
agtgtgattccaacggaagattcaactgccgtaggaacgcttgatcccggtcaatctgag
tctttctcgttgccgattgcaatcagcggtagcgccgagtctgggctccgttcacttgac
atggccatcaaataccgcaacgacgaaggtgagacaaggactttcgatgaattggctgta
gacgccgaggttgcttctgagcgcgatcgctttgatgccacgattgaaaaccgtactatc
caagcaggtggttcccgtgctgtcgatgttgcagtaacgaacaacctcaacgaagtcgca
agcgatgtcgaggtccgactgttcgccgacgatccgttagacacgggagataccgacacg
gggtacgttcagtcacttgacccgggtgagacaaaaacggtgacgttcgagttgactacc
accgggtctgcaacagtggggagtacctaccctatctctttggacttccgatatgacgac
accgaaggcgacagccatctcaccaagacttaccgacttccaattgatgtaatcgaaagc
caagagggtgggctaccgttgccagttatcgccgttgcgctcctcgttattggaacggcg
gcgctcgtcatctatcggaggcagcaatag

DBGET integrated database retrieval system