KEGG   Haloarcula marismortui: pNG5071Help
Entry
pNG5071           CDS       T00211                                 

Definition
(GenBank) transcription regulator
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N Sigma70_r4 UPF0122 Herpes_UL55 MNR
Motif
Other DBs
NCBI-ProteinID: AAV44490
UniProt: Q5V7M1
Position
pNG500:63698..64132
Genome map
AA seq 144 aa AA seqDB search
MDDLASQSFPEPERAIMKATYQVLCEYGYADLTIQQIADEYGKTTTAVHYHCDTKNKLLT
AFLDYLLEELADSVHNIRTTNPENRLKFLLDELLVKSKNEPVLSIALLEMQSQTPYKEPF
RERFKQMAVVNRQTELDFTVSETA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggacgatttagcaagccagagttttccagaacctgaaagggcgataatgaaggcaacc
tatcaggtactatgcgagtatgggtatgcagatcttacgatacaacagattgcagacgaa
tatggaaagactacgactgcagtacattaccactgcgatacaaaaaataaactcctcaca
gcgttccttgattaccttctggaggaacttgccgactcagttcacaatatcaggacaact
aatcccgaaaaccgcctcaagtttctgcttgatgaacttcttgtcaaatcaaaaaatgag
ccagttctctcgattgcgttattggaaatgcagagccagacgccatacaaggagcccttc
cgtgagcgttttaaacagatggccgtggtgaatcgccagacggagcttgatttcactgtt
tcagagactgcttga

DBGET integrated database retrieval system