KEGG   Haloarcula marismortui: pNG5074Help
Entry
pNG5074           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEDD_Tnp_IS110 DUF2312
Motif
Other DBs
NCBI-ProteinID: AAV44493
UniProt: Q5V7M5
Position
pNG500:65282..65599
Genome map
AA seq 105 aa AA seqDB search
MVRLNSVPESYVLTDEVREARALVRGRQTLVENRTKYANKIHGLLSDHGIIEDVKPITIE
GREFLRELSIPSPWDSLLESYIELIETLTEEIQNLEERSKSALGL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggtacggctgaactctgtccctgaaagctatgttctaaccgacgaagtcagggaagcc
cgcgcactcgtgcgcgggcgacagacgttagtcgaaaaccgtaccaaatacgccaacaag
atccacgggctcctttccgaccacggtatcattgaggacgtgaagccgataaccatagag
ggacgagagttcctgcgggaactctcgatcccgtcaccatgggactcgttactagagtcg
tacatcgagttgattgagacgctcaccgaggaaattcagaacctcgaagaacgatcgaag
agcgcgctgggtctctga

DBGET integrated database retrieval system