KEGG   Haloarcula marismortui: pNG5075Help
Entry
pNG5075           CDS       T00211                                 

Gene name
tnp
Definition
(GenBank) transposase
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_20
Motif
Other DBs
NCBI-ProteinID: AAV44494
UniProt: Q5V7N1
Position
pNG500:65617..65994
Genome map
AA seq 125 aa AA seqDB search
MTIPGVSYYTALSIYAELGEISRFDGDKSVVSYVGLNPVIRESGDSRIEGSISKRGSGRV
RWLLVQAANTAVHTCNDEYLSRFYERLASRKNSQKAIVACARKMLVLIYHMLDRGEVYDP
PDVSA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcccggcgtgagttactatacggcgttgtcgatttacgccgagttaggcgag
atcagtcggtttgacggtgacaaatcggtcgtcagttatgtcggattgaacccggtgatc
cgcgagtcaggcgactcgcggatcgaggggagtatttcgaaacgtggatccggtcgtgtc
cggtggttgctcgtccaggctgcaaatacagcagttcacacctgtaacgatgagtatcta
agccgtttctatgagcggctagcaagccggaagaattcacagaaggcgatcgtagcctgc
gctcggaaaatgctggtgttgatttaccacatgctagaccgaggcgaggtgtacgatcca
cctgatgtgagtgcgtag

DBGET integrated database retrieval system