KEGG   Haloarcula marismortui: pNG5076Help
Entry
pNG5076           CDS       T00211                                 

Gene name
tnp
Definition
(GenBank) putative transposase
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: AAV44495
UniProt: Q5V7N0
Position
pNG500:66432..67076
Genome map
AA seq 214 aa AA seqDB search
MPEICDRLGLHSDTLPDPTTFYHSLDRYAMYIWRALLRVSAQQLPQSGHVALDSTFIERQ
QASQHYLQRCGRRVKTIKATTLTDTESLAVLDVHCCIEREHDTKAGPRVVHRNVDDLRSV
VADNGFQDWNREYQVAALNVEYLVHYRGSSMMATANNALIRAKGYTQRWMAETTCSSVKR
TQAAALRSRFWYRQFREIVLLFALNNIKKLARTL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatatgcgaccgactcggccttcactcggatacgttacctgatccaaccacg
ttctaccactcactcgaccggtatgcgatgtacatctggcgggcgttgctgcgcgtttca
gcgcagcaactcccgcaatcaggccacgttgccttggacagcacattcatcgagcggcag
caggcttctcaacactacctccaacgctgtggccggcgcgtaaaaacgatcaaagcgacg
acgctgaccgatacagagtcgttagcagtgctggacgtacattgctgtatcgagcgtgaa
cacgacacgaaggctggaccgcgggtcgtccaccggaacgtggacgacctgcggtctgtc
gtcgccgacaatgggttccaagactggaacagggaataccaagttgctgcgctcaatgtc
gagtatctcgttcactaccgcggatcttcgatgatggcaaccgccaataacgcactcatc
cgagcaaagggctacacgcaacgctggatggctgaaacaacgtgctcctcggtcaagcga
acgcaggccgctgccctgcgttcgcggttctggtaccgacagttccgtgaaatcgttctt
ctcttcgctctcaacaacatcaagaaactcgctagaacgctctaa

DBGET integrated database retrieval system