KEGG   Haloarcula marismortui: pNG5078Help
Entry
pNG5078           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4625 Cadherin-like
Motif
Other DBs
NCBI-ProteinID: AAV44497
UniProt: Q5V7M8
Position
pNG500:complement(67780..69666)
Genome map
AA seq 628 aa AA seqDB search
MQKVALRHIMRIFIIIVLLSTTVAGTATAEPVVTVSTASGEISEGETIKTTDEVTININA
AADSMITVVEIRIDGDVVKTYEPKSNTFSKTTTPDTGDGEQNVEIIVSSDRVTTFNYTIV
QDSIPPVIEYTSPVQRYSGRSSPSNVTVENAYVNLSGNISDTTGVNTVSIRRTYQHSSNA
SSGQSVRTYRINNPGNRFNQQLFLGSGENELLARYTDEMGNVRRHEFTISVSDSENPKIS
LTVPNRTFNQQVEMQVSVTDNVQLQTVTVERPDGTGFRPITESNPEPDPSLLSTKISRNI
SLDEGKNNISVTATDRDGNSASESATITYNRQIEPKITIYRNQTQITNGNLSLQAAVIQG
EITRVSVETINLTTNDIVDLQLIYSGTVRERVDIGEIIALAGGRTQVQVSATDSEGELHT
NVLVADNRSGKVFINESSLADERSAQTATETQAVSNESSNDSNSSNTPGTDEAIQETITA
TTTGATTEPTEIPASTAIEATGVSVVVAKINQTQIQLGDTVTVNASIENRRRINQDVVVP
VAANGEVIYTQNKTIPKNSTINMSLQYTANKPGNVSLQVGSAPAGKISVSEDSGLVPLDL
VRNGLIVFGSIVIGGYLILKSLAIYLGY
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagttgctctacgacatataatgagaatttttatcattatagttctgttgtcc
acaacagtggcgggaacagcaactgctgagccggtggtcactgtttcaacagcaagtgga
gagatatcggagggagaaacaatcaaaactactgatgaggtgacaatcaatatcaacgca
gctgcggactcaatgattactgttgtcgagattcgaatagatggagatgttgtcaaaacg
tatgagccaaaatccaataccttctcaaagacaaccactcccgataccggagacggagag
caaaatgtggaaataatcgttagttcagatagggtcaccacattcaattatacaatcgta
caagatagcataccaccagttatagagtatacaagcccagttcagagatatagtggtaga
tcctcgccaagcaacgtaaccgtagagaatgcctatgtgaacttatctgggaatatatca
gatactaccggggttaacactgtaagcatccgtcggacatatcaacatagctctaacgca
tcaagcggtcagtctgttagaacctatagaatcaacaatcctggcaataggttcaaccaa
cagctgtttcttggcagtggcgagaacgaactgctagcccgatacacagatgagatgggg
aacgttagacgccatgaattcacaatctctgtctctgatagcgaaaacccgaaaataagc
ctgacagtgccgaacagaacattcaaccagcaggttgagatgcaggtgtcagtcaccgac
aatgtccaactccagacggtgacggtagaacggcctgatgggacaggatttcggccaatt
acagagagcaatccagaaccagacccgagcctattatcaactaagataagcagaaacatc
agcttagatgagggaaagaacaacattagtgtcactgcaacagatcgcgacggcaatagc
gcctcagagtcagctacgattacctacaacagacagattgagccgaaaataactatctac
cgcaatcagacccaaataacaaatggcaacctaagcctccaagccgcagtaattcagggc
gagatcacgcgtgtaagtgttgaaacaatcaatctcactaccaatgatatagttgacctc
cagttaatctatagcggtaccgtgcgagagcgggttgatattggtgagattattgccttg
gccggtggccgaacccaagtacaagtgagtgccactgactcagagggggagctacatact
aatgtactagtagctgataatagatctggaaaggtatttattaatgagtcctcgttagct
gatgagaggtcagctcaaaccgctaccgagacacaggctgtgagtaatgagagtagtaac
gactcgaacagctcaaacacaccaggtacagatgaagcaatacaagagacgattactgcc
acaacaacaggagccacgactgaaccaactgaaataccggccagcacggcaatagaggca
actggtgtctcggtagttgttgccaaaataaatcaaacgcaaatacagcttggtgatact
gttaccgttaatgcctccatcgagaacagaaggagaataaatcaggacgtagtggttcca
gtagctgccaatggggaggtaatctacactcaaaataagacgattcctaagaattcgact
ataaatatgagtctccagtatactgcaaataaacccggaaatgtctcactacaggttggt
agcgctcccgccggaaaaattagtgttagtgaggattcgggacttgttcctctggatttg
gttcgaaacggactaatcgtattcggtagcatcgtcataggtgggtacttaatcctcaaa
tcgttagctatctacctcgggtactaa

DBGET integrated database retrieval system