KEGG   Haloarcula marismortui: pNG5104Help
Entry
pNG5104           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mrr_cat
Motif
Other DBs
NCBI-ProteinID: AAV44518
UniProt: Q5V7Q7
Position
pNG500:complement(91656..92771)
Genome map
AA seq 371 aa AA seqDB search
MTTDTEIALLRIQPDTLEQLASDVLSAYGYDVNPSGTQGTDAGRDAYVTIGGQAGIAHYS
KQKTWRQKLRKDASKAGDHEREYEIFVFVTNQEVTGQQEMDMREEVREEYDWELDLWHLE
RLRNKLETDLPEIAQRHLGVDPQGRPDSIEAIEDLKQSRIEAIIDREEIPVNLEDGPFVA
IHLLPNGMESMEYGVPPSELPTPPKFGDEEAPFDGDPIDIGKTFVRERGADEHRDYTFIH
EDGWIEAVSTYFVGHDGTFPAHKFDTEVVKTVRGSLKCLKEIGAKPPIFAYLTVHGFKDV
EMWYEKRVHGPQDAKIPRETMSLTRAEITAFDESTPQALKPVLDRFWNGCGWSVGCIDYS
DGEWDPYYKGR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagataccgagatcgcacttttacgtattcaaccagacacattagaacagttg
gcttcagatgttctctccgcatacggatacgatgttaatccgagtggaacccaaggaact
gacgccggacgagacgcatatgtgaccatcggtggtcaagcaggtatagcacattacagt
aaacaaaaaacgtggcgacagaaacttcgtaaagatgcttctaaggcaggagatcacgag
cgagaatatgagatatttgtctttgtgacgaatcaagaagtgactggtcagcaggagatg
gatatgcgagaagaagttcgagaagagtacgattgggaacttgatctgtggcatcttgag
cggttgcgtaataagcttgagacagacctgcccgaaattgctcaacgtcatttgggtgtc
gatccgcagggaaggccagacagcattgaggctattgaagatttgaagcagtcacgaatt
gaagcaataatagatcgggaggaaatccctgtaaatcttgaagacggtccctttgtggcg
attcacctgctaccgaatggaatggagagcatggaatatggggttcccccctctgaattg
ccgacgccacctaagttcggagatgaagaggctccgttcgacggcgatccaattgatatt
ggtaaaacttttgttcgtgagagaggcgctgacgagcatcgtgactacacattcattcac
gaggatgggtggattgaggctgtttcaacctactttgtcggccatgatggaacgttccca
gcacataaattcgacacagaggtggtcaaaacggttcgtggatcgttgaagtgcttgaaa
gagattggagcgaaaccgcccatattcgcatatcttacggtccatggtttcaaagatgtt
gagatgtggtatgaaaagcgcgttcacggtccacaagatgcaaaaatcccaagagagacc
atgtcacttactcgtgctgaaattacagcgttcgacgaatctacacctcaggcattgaaa
ccggttcttgatcggttctggaatggttgtggatggagtgtgggttgcatagactactcc
gacggtgaatgggacccgtattataaagggcgttaa

DBGET integrated database retrieval system