KEGG   Haloarcula marismortui: pNG5111Help
Entry
pNG5111           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HypA zinc_ribbon_15 DZR DUF4596 Baculo_LEF5_C
Motif
Other DBs
NCBI-ProteinID: AAV44525
UniProt: Q5V7R1
Position
pNG500:complement(98832..99851)
Genome map
AA seq 339 aa AA seqDB search
MTNATKRVTDRNPEYDPADILGAASSDPETRGNGRERVLDSTGYPDRTEDETRTCTTCGQ
DIPRDERQCPFCAQTGISETSFDDQGSSPLGEWTFGRVVLALVEANTDFHARALGAAAFS
VSDSIATGEDTSHGTVKCRAAFGTEPAATLTKGWPDLPTETTIDEEPGQALLETADEQTN
WDGDGDDVQPRIYLEDGSPVTDRSEFQQLTDEFREDDGTYWLVPGVVKRHQARAEPEMIG
IGFYCRQCGAVTGHESHGLDGFECHPHLDRMIWTCRECGQHRHEPEQEDDTADVTGYEHL
PDGVSPEDIHGDEPDFQEQEFQDQISAYRERNGFFPWER
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgcaaccaagcgtgtgactgatcgaaatcctgagtacgatcccgctgatatc
ctcggcgcagcgagttcagatcctgaaacgagggggaacggacgggaacgagtcctcgac
tccaccggctatcccgaccgtacagaggatgagactcgtacctgtacgacctgtggacag
gatatcccacgggatgaacgccagtgtccattctgcgctcaaaccggcatctcagagact
tcgttcgacgatcaaggtagtagtccacttggggagtggacgttcgggcgggtagtactc
gcgctcgtcgaagcgaacactgacttccatgcacgagcgctcggcgctgcggccttctcc
gtttccgacagcatcgcgaccggcgaagacacctcccatggaacggtgaagtgccgagca
gccttcgggaccgagccagccgccactctcacgaagggctggcccgacctgccgaccgaa
accacgatcgacgaggaacccggacaggcgctcttggagacagccgacgagcagaccaac
tgggacggggatggggacgacgtccagccacggatctatctcgaggacgggtcgccggtc
accgaccgttcggagttccagcagctcacggatgagttccgggaagacgacggcacgtac
tggcttgttcccggcgttgtgaagcgccatcaggcaagggcagaaccggaaatgatcggc
atcggattctactgccgccagtgtggcgccgtgacaggacacgaatctcacggactcgat
ggcttcgagtgccacccacatcttgaccgcatgatctggacctgcagggagtgtgggcag
caccgacacgagcccgaacaggaagatgacacggcggacgtcacgggctatgagcatctt
cccgacggcgtctcaccggaggatatccacggcgacgagccagacttccaggaacaagag
tttcaggaccagatcagtgcctatcgcgagcggaatggcttcttcccgtgggaacggtag

DBGET integrated database retrieval system