KEGG   Haloarcula marismortui: pNG5114Help
Entry
pNG5114           CDS       T00211                                 

Definition
(GenBank) unknown
  KO
K07065  uncharacterized protein
Organism
hma  Haloarcula marismortui
Brite
KEGG Orthology (KO) [BR:hma00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    pNG5114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN DDE_Tnp_ISAZ013 PIN_3
Motif
Other DBs
NCBI-ProteinID: AAV44528
UniProt: Q5V7R7
Position
pNG500:100976..101407
Genome map
AA seq 143 aa AA seqDB search
MAAVVVDANVLIATRLSRDQNHERGKAITQAVDQGVLPTAYILSDVLEEVINYLQARAGH
NVATETLDAIIESSGFSLRQSSKSDFDTGRSLFRRYESLSLTDAIIVATMQREEIEYLYS
FDDGFDDVSSLTRLTTPDNPFEQ
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggttgttgtcgacgcaaacgtcctcatcgctactcgtctctctcgcgatcag
aatcacgaacgtggcaaagcaattacgcaggcggtagaccaaggagtcctcccgacagcg
tacatcctgagtgacgtgctcgaagaggtcatcaactatcttcaggcaagggctgggcac
aatgttgcgactgaaacgcttgatgctatcatcgagagcagcgggttctcactcagacag
agttcaaagtctgatttcgacactggccggtcgctgttccgacgctacgagtccctttca
ctgactgatgccattattgtcgcaacgatgcaacgagaagagatcgaatatctctacagc
tttgacgacggatttgacgatgtttcctcactcactcgcctcacgacacctgataacccg
tttgagcagtag

DBGET integrated database retrieval system