KEGG   Haloarcula marismortui: pNG5125Help
Entry
pNG5125           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 Vesiculo_matrix
Motif
Other DBs
NCBI-ProteinID: AAV44538
UniProt: Q5V7P9
Position
pNG500:complement(109074..109493)
Genome map
AA seq 139 aa AA seqDB search
MMRGFLHCYYKDIYGIRPVGRELHNTVVWLGRGFDSPPSRDAVDRFLTDLEHVVDDVFDR
FVEQAARRGLLDLTYCIDSTDVRAMPADQDASKCYDPTDDEYYYGYGCTIVSTGQKIPIA
AEFTESKQAPEEDGDARHT
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtggcttcctccactgctattacaaagacatctacgggattcgtcctgttgga
agagagctgcacaacacggttgtctggcttggccgtggctttgattcaccgccgtcgaga
gacgcggtcgatcgctttctcaccgacctcgaacacgtcgtcgacgacgtattcgaccgg
ttcgtcgagcaggccgcccgccgcggcctgctcgacttgacctactgtatcgattcaacc
gacgtgagggcgatgcccgccgatcaagacgcgtcgaaatgctatgatccaaccgacgac
gagtactactacggctacggctgcacgatcgtctcgaccggacaaaagatcccgattgcg
gcggagttcacagagagtaagcaagcgccagaagaagacggcgatgcgcgtcacacgtga

DBGET integrated database retrieval system