KEGG   Haloarcula marismortui: pNG5134Help
Entry
pNG5134           CDS       T00211                                 

Definition
(GenBank) unknown
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Per1
Motif
Other DBs
NCBI-ProteinID: AAV44546
UniProt: Q5V7Q5
Position
pNG500:118252..118590
Genome map
AA seq 112 aa AA seqDB search
MHDDTNEESGSGPADQPESEDTGSTTVRDNWKESDRPSVATVEAVAAATNREMTDLPPLH
ETIDASALDTLLNGQPSSVTISFRYADTAVSMSGDGSIEVHVERNSREEDSG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgatacaaatgaggaaagtggctcaggtccagccgatcaacccgaaagcgaa
gatacaggttccactacagtacgtgataactggaaggaatcggatcgccccagtgttgcg
accgtcgaagcagtcgcagcggctaccaatcgtgaaatgactgacctgccacccttgcac
gagacgatcgatgccagtgcactcgatacactgctcaatggacagccatcatcagtaaca
atctccttccggtacgcagacaccgctgtctcgatgagcggggatggaagtatcgaagtc
cacgtcgagagaaactctagagaagaagatagcggataa

DBGET integrated database retrieval system