KEGG   Haloarcula marismortui: pNG7103Help
Entry
pNG7103           CDS       T00211                                 

Gene name
adh7
Definition
(GenBank) putative zinc-binding dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00071  Fatty acid degradation
hma00350  Tyrosine metabolism
hma00625  Chloroalkane and chloroalkene degradation
hma00626  Naphthalene degradation
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7103 (adh7)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7103 (adh7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7103 (adh7)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7103 (adh7)
   00626 Naphthalene degradation
    pNG7103 (adh7)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7103 (adh7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 CBP_BcsN ADH_N
Motif
Other DBs
NCBI-ProteinID: AAV44815
UniProt: Q5V6N7
Position
pNG700:103269..104258
Genome map
AA seq 329 aa AA seqDB search
MSARTLYFTGGKSVRVDEEAVPDPGPSEVRVRTELSGISPGTELLVYRGEVDSELATDET
IDALDGTFSYPLQYGYAAVGCVTAVGDAVDDDWLDQRVFAFNPHESHFLAEPSSLIPTTL
PPEQAVFIPNVEAAVNFVMDARPRIGARVVVFGQGPVGLLTTGLLADFPLASLVTVDPCA
GRRRLSEALGADRSVSPGNLDDDDADITFELSGNPTALDRAIDATGYAGQVIVGSWYGSK
DVSLDLGHHFHRSHIRLRSSQVSRIDPDHADRWDKDRRLDVVRSWLSDTDLSALLTHEID
IERAAEAYQLLESRPDDAVQVVLTYNGHP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagaacgctgtactttaccggcgggaagtcggttcgggttgacgaagaagcg
gtgcctgaccccggaccatcggaggtccgtgttcgaaccgaactctcaggaatcagtccc
ggaacagagctgttggtgtaccgtggtgaggtcgattcggaactcgcgaccgacgagacg
atcgacgcccttgatggtacgttctcgtatccactgcagtacggctacgccgctgtcggc
tgtgtcacggccgtcggggacgcggttgacgacgactggctcgaccagcgtgtgttcgcg
ttcaacccacacgaaagccacttcctcgccgagccgtcgtcgcttattcccacgacgtta
ccgccggagcaggcggtgttcatcccgaacgtcgaagcagcggtcaacttcgtgatggac
gctcgaccgcgtatcggggctcgggttgtcgtcttcggtcaggggccggtgggcctgttg
acgaccgggctgctggccgattttccgctggcgtcgctcgtgacggtcgatccctgtgcg
ggccgccgtcggctctcggaagcgctcggggcagaccgctcagtctctcccgggaatctc
gatgacgacgacgccgacatcacgttcgagctctcggggaacccaaccgcactcgacaga
gcgatcgacgccactggctatgccggtcaggtcatcgtcggttcgtggtacggctcaaag
gatgtctcgcttgacctcggacatcacttccaccggagccacatccgccttcgcagcagt
caggtgagccgcatcgatccggatcacgccgaccgctgggacaaggaccggcggctggat
gtcgtccggtcgtggctgagcgacactgacctctcggcgctactgacacatgagatcgat
atcgagcgtgcagccgaagcgtatcaactgctagagagccggccagacgacgctgtacag
gtagtgttgacgtacaacggacacccgtga

DBGET integrated database retrieval system