KEGG   Haloarcula marismortui: pNG7239Help
Entry
pNG7239           CDS       T00211                                 

Gene name
selD
Definition
(GenBank) putative selenophosphate synthase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
hma  Haloarcula marismortui
Pathway
hma00450  Selenocompound metabolism
hma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    pNG7239 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hma03016]
    pNG7239 (selD)
Enzymes [BR:hma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     pNG7239 (selD)
Transfer RNA biogenesis [BR:hma03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    pNG7239 (selD)
 Prokaryotic Type
    pNG7239 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C
Motif
Other DBs
NCBI-ProteinID: AAV44940
UniProt: Q5V6B2
Position
pNG700:247358..248011
Genome map
AA seq 217 aa AA seqDB search
MADALDAMDGVIAGGHTIMSPWPFAGGAISATGRPDALLTSQGASPGDRLYLTKPLGTQP
AMGATRVTDEQFVETVTDATDRPLDTIASEAIAWMTTPNRDATVACREYATAATDITGFG
LVGQSRVVAARSNVGIELTHLPVITGTPALSTLFGYGLTAGESAETSGGLFVSVPPTATD
AVETAFDDAGVFYRAVGRVTAGRGVSLSDPTIEEVSR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcactggacgcgatggatggcgtcatcgccggcggtcacaccattatgagt
ccgtggcccttcgccggcggggccatctcggcaacggggcgtcccgacgccctcctcacc
tcgcagggagccagtcccggcgaccggctctacctgaccaaaccgctcgggacacagcca
gctatgggggcgacccgcgtgactgacgagcagttcgtcgagacggtcaccgacgccact
gaccggccgctcgacaccattgcttcggaggctattgcgtggatgaccacaccgaaccgg
gacgcaacagtcgcgtgccgcgaatacgcgacagccgcgactgatattaccggcttcggc
ctcgtcgggcagagccgcgtggtggccgcccgctcgaacgtcggtatcgaactgacacat
ctcccggtcatcacgggaacgcctgccctctcgacgcttttcggatacgggctgactgcg
ggcgagagcgcggagaccagcgggggactgttcgtctccgtcccgccgactgcgactgac
gccgtcgaaacggcgttcgacgacgccggcgtgttctaccgtgctgtcggacgtgttacg
gccggacgcggtgtctcactttcggacccgactatcgaagaagtcagccgctaa

DBGET integrated database retrieval system