KEGG   Haloarcula marismortui: pNG7278Help
Entry
pNG7278           CDS       T00211                                 

Gene name
adh12
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00071  Fatty acid degradation
hma00350  Tyrosine metabolism
hma00625  Chloroalkane and chloroalkene degradation
hma00626  Naphthalene degradation
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7278 (adh12)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7278 (adh12)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7278 (adh12)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7278 (adh12)
   00626 Naphthalene degradation
    pNG7278 (adh12)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7278 (adh12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AAV44977
UniProt: Q5V676
Position
pNG700:complement(289525..290679)
Genome map
AA seq 384 aa AA seqDB search
MFLYLYSIFGNCFHPITRPGGCDRRHENGFPQPTRNGSMRAAIYRGPGDITVEEVPRPEI
ESPTDAIVRVTHTAVCGSDLWFYRGQSDREEGSRVGHEPMGIVEEVGDDVRSVEPGDRVF
APFVVSCGRCEFCRKGLHTSCVNGDSWGGDNGGGQGEYVRATEADGTLVRVPDRHADDED
TLEAILPLTDVMGTGHHAAVSAGVSEGDTCIVVGDGAVGLCGVLAARRLGAERIIAMGHH
EDRLELAESFGATETVAARGQDAVDAADDLTNGGANHVLECVGAASAMETAIDVCRPGGT
VGYVGVPHGLDDSGLDMFSLFGDNIGLNGGIAPVRAYADELLADVLQGTLDPSPIFTKTV
DLNGVPEGYQAMDEREAIKVLVKL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtatttatattccatctttggtaattgttttcatccaataacacggccgggc
ggatgcgacagacggcatgagaacggttttccacagccgacccgaaacggatctatgcgc
gcagccatctaccgtggccccggtgatatcaccgtcgaagaggttccccgacccgaaatc
gaatcgccaactgacgcgattgtacgcgtgacccacactgccgtctgtggctccgacctg
tggttctaccgcggccagagcgaccgtgaagagggctcccgcgtcggccacgaaccgatg
ggtatcgtcgaggaagtcggcgacgacgtgcgctcagtcgaacccggcgaccgggtgttc
gccccgttcgtcgtcagctgtggccggtgtgagttctgtcggaagggactgcacacgtcc
tgtgtcaacggcgactcatggggcggcgacaacggcggcggccagggcgagtacgtccga
gcaacggaagccgacgggacgctcgtccgcgtcccagaccgccacgccgacgacgaggac
acgctggaagcgattctgccgctgacagacgtgatgggaacgggccaccacgcggcggta
agcgccggtgtcagtgaaggcgacacctgtatcgtcgtcggcgacggggccgttggacta
tgtggcgttctcgcggcgcgacgcctcggtgcggaacgcatcatcgcgatggggcaccac
gaggaccgcctcgaactcgctgagtcgttcggtgcgacagagaccgtcgccgcccgtggt
caggacgccgtcgacgccgcggacgacctgactaacggcggtgcaaatcacgtcctcgaa
tgtgtcggtgcggcctcggcaatggagaccgctatcgatgtctgtcgtcctggcgggacc
gtcggctacgtcggcgtcccacacggcctcgatgattccggattggacatgttctcgctg
ttcggcgataacatcgggctcaacggtggcatcgcaccggttcgtgcctacgccgatgaa
ctgctggccgatgtgctgcagggcacgcttgacccgtcaccgatcttcacgaaaacagtc
gacctcaacggcgttccagaagggtatcaggcgatggacgagcgcgaggcgatcaaagtt
ctcgtcaagctgtaa

DBGET integrated database retrieval system