KEGG   Haloarcula marismortui: pNG7380Help
Entry
pNG7380           CDS       T00211                                 

Gene name
fhs
Definition
(GenBank) formyltetrahydrofolate synthetase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
hma  Haloarcula marismortui
Pathway
hma00670  One carbon pool by folate
hma00720  Carbon fixation pathways in prokaryotes
hma01100  Metabolic pathways
hma01120  Microbial metabolism in diverse environments
hma01200  Carbon metabolism
Module
hma_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:hma00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    pNG7380 (fhs)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    pNG7380 (fhs)
Enzymes [BR:hma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     pNG7380 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AAV45070
UniProt: Q5V5Y2
Position
pNG700:393041..394972
Genome map
AA seq 643 aa AA seqDB search
MLPNLDFATATVRPALGSENYSRKPRYMMWLSGSATVSRTHPIPVVSASLTLLRRCREML
VEMSSQDEQSATEETQEPIPTDYDIAQSTDMEPIWELVEPWGLGLDDLQYFGEYTAKVKQ
HAIERLREQAENREQNLVLVTGMTPTPKGEGKTVTTVGLGQTLNHVGEEAMIAIREPSLG
PVFGVKGGAAGGGRSQVLPMEDINLHFTGDLHALTSAHNLIAAMLDAKISQGDDLNIDIN
NVSWPRAIDMNDRALRETVVGLGGKTGGTPREDSFILTAASELMAVLCLASDIGDLKERV
SRIIVAYDEDGDPVTVEDIEATGPATMLLRDAIKPNVVQTIEGTPALVHGGPFANIAHGT
NSLVADKTAFGMGDYLVTEAGFGSDLGAEKFMDVVCRKGDMTPNAVVLVASVRALKYHGL
NQWPVDYDEIGEAGVEAVEAGFSNLDKHARNLQKFGVPVVVSVNRFPDDTDEEVQAVLDH
CREDLGVRAAESNVFSDGSEGGVDLAENVIEATEESNEEDFRMLYDDDDSIKEKIHTVAT
EIYGADDVKYTGGALDDIEQMNDLDFDDYPVVMSKTFHSLSDDASQKGAPEGWELEISEV
YPSAGAGFLVALTADALTMPGLPARPAAADMDIDGDGNISGLF
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgctcccaaatctcgacttcgcgaccgctactgtccggcctgctcttgggtctgagaac
tactctcgtaagccgagatacatgatgtggctttcggggtctgcaacggtatctcgaaca
catcctatcccggtagtgtcagcttcactaacattattacgacggtgcagggaaatgcta
gtcgagatgtcttcacaggatgagcaatccgcgaccgaagaaacacaggagccgattccg
acggactacgacatcgcccagtcgaccgacatggagccgatctgggaactggtcgaaccg
tggggactcggcctcgatgacctccagtacttcggcgaatacaccgcgaaagtcaaacaa
cacgccatcgagcgtctccgcgaacaggccgaaaacagggagcagaacctcgtgctggta
accgggatgacgccgacgccgaaaggcgaagggaagacggtaaccaccgtcggtcttggg
caaacgctcaatcacgtcggcgaggaggcgatgatcgcgatccgagaaccgtcgcttggc
ccggtgttcggggtcaagggcggcgcagcgggtggcggccggtcgcaggtcctcccgatg
gaggacattaacctccacttcaccggcgacctccacgcactcacctcagcacacaacctt
atcgccgcgatgctcgatgcgaagatatcacagggcgacgacctgaatattgatatcaac
aacgtctcctggccgcgggctatcgacatgaacgaccgcgcactccgtgagacggtcgtc
ggcctcggcgggaagaccggcgggaccccgcgagaggatagcttcattttgacggcggcc
tccgagttgatggcggtcctctgtctggccagcgatatcggggacctgaaagagcgcgtc
agtcgaatcatcgtcgcctacgacgaagacggcgacccggtgaccgtcgaggacatcgag
gcgaccggcccagcaaccatgcttctccgggatgcgatcaaaccgaacgtcgtccagact
atcgaggggacgccggcactggtccacggcggaccgttcgcgaacatcgctcacgggacg
aactcgctggtcgccgataagacagcattcggcatgggcgactacctcgtcactgaggcc
ggcttcggctccgacctcggggccgagaagttcatggacgtggtctgtcgcaagggcgac
atgacgccaaacgccgtcgtactcgtagcgtcggttcgtgcgctcaagtatcacggactc
aaccagtggcccgtcgactacgacgagatcggcgaggccggcgtcgaagccgtcgaagcg
ggcttctcaaacctcgataagcacgcgcggaatctccagaagttcggcgtcccggtcgtc
gtctccgtcaaccgcttcccggacgatactgacgaggaggttcaggccgtgctggaccac
tgccgcgaggacctcggcgtcagagcggctgagtcgaacgtgttctccgacggcagcgag
ggcggcgtcgacctcgccgagaacgtcatcgaggcgaccgaggagagcaacgaggaggac
ttccggatgctgtacgacgacgatgacagcatcaaggagaaaatccacactgttgcgacc
gagatctacggtgctgacgacgtgaaatacaccggtggcgcgcttgacgacatcgagcag
atgaacgacctcgacttcgacgactacccggtcgtcatgtccaagaccttccactcgctg
agcgacgacgcgagccagaagggtgcgccggagggctgggaactcgaaatcagcgaagtg
tacccatccgctggcgcgggcttcctcgtcgcacttacggccgacgcgctcacgatgccc
ggcctaccggcccgtccggccgcggccgacatggatatcgacggggacggcaacatttcg
ggactgttctga

DBGET integrated database retrieval system