KEGG   Haloarcula marismortui: rrnAC0362
Entry
rrnAC0362         CDS       T00211                                 

Gene name
serA4
Definition
(GenBank) phosphoglycerate dehydrogenase
Organism
hma  Haloarcula marismortui
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored DUF4440
Other DBs
NCBI-ProteinID: AAV45407
UniProt: Q5V4Z5
Position
I:319427..320380
AA seq 317 aa
MADIVVTRYGVHGMPVDQYVTALRERLPEWDVAVAETPEAERDLIADATVLTGNDVSPEL
VDTADSLKLFAGTYAGYDHLPLSDLADRDIALTTASGVHGPNVAENVVGSWLAFARGFFT
ARRHQRDHIWQSFHTDDFAGSRVCVVGLGEIGEAIVDRVQGFDVETVGVRYSPEKGGPTD
EVYGFDEIHEAVTDTEYVGLACPLTDATRHLIDAAVFRTMHPDAVLTNVARGPVVDTDAL
VSALQRNHIGGAALDVTDPEPLPSGHPLWDFENVLITPHNAGHTPSYYERLADIVAENVQ
KAERTGEWGGLRNQIDL
NT seq 954 nt   +upstreamnt  +downstreamnt
atggccgacatcgtcgtgacgcgctacggcgttcacggaatgccggtcgaccagtacgtg
acagcgctccgggaacgactgccggagtgggatgtcgccgtcgcagagacgcccgaagcc
gagcgggacttgattgcggatgcgacagttctgaccggcaacgatgtctcgccggaactg
gtcgatactgccgactcgctgaagctgtttgcagggacatacgctggatacgaccacctc
ccgctctcggacctggcagaccgtgacatcgcgctcacgacggcctccggcgtccacggg
ccgaacgtcgccgagaacgtcgtcggctcgtggctcgcctttgcccggggtttcttcact
gcccgtcgccaccagcgcgaccacatctggcagtcgttccacaccgacgacttcgccggg
agccgcgtctgcgtcgtcgggctgggagaaatcggcgaagcaatcgtcgaccgcgtgcag
ggattcgacgtggagaccgttggcgtccgctactcgccggagaagggtggcccgacggac
gaggtgtacggcttcgacgagatccacgaagcggtcaccgacacggagtacgttgggctc
gcctgcccgctcaccgacgcgacgcgccaccttattgacgcggcggtgttccggacgatg
catcctgacgccgtgctcaccaacgtggcccgcggcccagttgtcgataccgacgcgctg
gtcagtgcgcttcagcgcaaccacatcggcggcgcggcactggacgtgaccgaccccgaa
ccgctgcccagcggccatccgctgtgggacttcgagaacgtcctcatcacgccacataac
gccggccacacgccgagctactacgaacggcttgctgatatcgtcgccgagaacgtccag
aaggccgagcgaaccggcgaatggggcggtctcaggaaccaaatcgacctctag

DBGET integrated database retrieval system