KEGG   Haloarcula marismortui: rrnAC0537Help
Entry
rrnAC0537         CDS       T00211                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00051  Fructose and mannose metabolism
hma00562  Inositol phosphate metabolism
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
hma01230  Biosynthesis of amino acids
Module
hma_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC0537 (tpiA)
   00051 Fructose and mannose metabolism
    rrnAC0537 (tpiA)
   00562 Inositol phosphate metabolism
    rrnAC0537 (tpiA)
Enzymes [BR:hma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     rrnAC0537 (tpiA)
Exosome [BR:hma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   rrnAC0537 (tpiA)
  Exosomal proteins of bladder cancer cells
   rrnAC0537 (tpiA)
  Exosomal proteins of melanoma cells
   rrnAC0537 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS
Motif
Other DBs
NCBI-ProteinID: AAV45555
UniProt: Q5V4J7
Position
I:470253..470900
Genome map
AA seq 215 aa AA seqDB search
MFVLVNLKAYPCDPVEVATAAADVSDDSGVRVAVAPQAAQISAVAETGVETWAQHVSAVE
HGSHTGSTLAEAAADAGAVGTLLNHSENRLKLADIDGALDAADRADLETIVCANNPAQIG
AAAALDPDGVAVEPPELIGTGTPVSKADPDIVTGAVDAAARVNGDVDVLCGAGISTGEDL
VSASDLGASGVLLASGVAKADDPRAALEDLVEPLL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtccttgtcaatctgaaggcgtacccgtgtgacccagtcgaggtagcaaccgct
gctgctgacgtcagcgacgattccggcgttcgcgttgccgtcgcgccacaggctgcccag
atcagcgctgtggcggagaccggcgtcgaaacgtgggctcagcacgtcagcgccgtcgag
cacggcagccacaccggcagcaccctcgccgaggccgctgcagacgccggtgccgtcggg
acgctgctgaaccactccgaaaaccggctcaagctcgcggacatcgatggggcactcgac
gccgccgaccgcgcggacctcgaaacgatcgtctgtgcgaacaaccccgcacagatcggc
gcggccgccgcgctcgaccccgacggtgtggccgtcgagccaccggaactcatcgggact
ggcacgcccgtcagcaaggcagacccagatatcgtgaccggcgcagtcgatgctgccgct
cgcgttaacggtgacgtggacgtgctctgtggggccggcatctcgaccggcgaagacctc
gtctcggcgagcgacctcggcgcgagcggcgtcctactggcaagcggcgttgcgaaggct
gacgacccgcgcgccgcactcgaagacctcgtcgaaccgctgctgtaa

DBGET integrated database retrieval system