KEGG   Haloarcula marismortui: rrnAC0917Help
Entry
rrnAC0917         CDS       T00211                                 

Gene name
sorD
Definition
(GenBank) sorbitol dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
hma  Haloarcula marismortui
Pathway
hma00030  Pentose phosphate pathway
hma01100  Metabolic pathways
hma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    rrnAC0917 (sorD)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     rrnAC0917 (sorD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AAV45891
UniProt: Q5V3L1
Position
I:complement(791803..792942)
Genome map
AA seq 379 aa AA seqDB search
MRPSASVGQRPEERLNPQCSHSLPGMKVIGVTRDDDGPQLLERERPSPDPGEALVRTLRV
GVDGTDHEVLNGSHGGFPDGADHMILGHEAVGVVEEPNGTGLEAGQVVAPTVRRKPNGET
NEYFRRGEPDMAPDGEYTERGIVGDHGFMAEYFTSPADFLVPVPKSVAEYGFLVEPLSIT
EKANEHAYATREPFDWRPDSACVLGNGSLGLLTLWMLDQEYDRTYCVGRRDRPDPTVDII
DEIGSTYVDSRETPVDELPGAYEAMDYIYEATGFAPHAFQTVKALDQNGVGVLLGIPEPW
EFEVDGGSLHNEIVLHNKCLIGTVNSHVSHFEDAVETLQELPAWLLDDLVTTVTDPEHVE
AAFEDGDDQIKAVVEFDSL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgtcagcatcggtaggacagagacctgaagaaagacttaatccccagtgttct
cactctctgcctggcatgaaagtgattggtgttacgcgggacgacgacggtccacagctc
ttagagcgggagcgaccgtcgcctgacccgggcgaggcactcgtccgcacactccgcgtt
ggtgttgacggcacagaccacgaagtcctgaacgggtcccacggcgggttccccgacggg
gcagaccacatgattctcggacacgaggcggtcggcgtcgtcgaagagcccaatggcacg
gggctcgaggcggggcaggtcgtcgcaccgaccgtccgacggaaaccgaacggtgaaacg
aacgagtacttccgccggggtgagccagatatggcacctgacggcgagtacacggaacgg
ggcattgtcggcgaccacggcttcatggccgagtacttcacgtcaccggcggatttcctc
gtcccggtccccaaatcagtcgcagagtacggcttcctcgttgagccgctctctatcacc
gagaaggccaacgagcacgcgtatgcgacgcgggaaccgttcgactggcgaccggactcc
gcctgcgtgctgggcaacgggtcgctcggactgttgacgctgtggatgctcgaccaggag
tacgaccggacgtactgtgtcggtcggcgggaccgccctgacccgacggtcgacatcatc
gacgagatcggcagcacgtacgtcgattcccgcgagacgccggtggacgaacttccgggt
gcctacgaggcgatggactacatctacgaggcgaccgggttcgccccccacgcgttccag
acggtcaaggcgcttgaccagaacggggtcggcgtgttgctcggcatcccggagccgtgg
gagttcgaagtcgatggcggctcgctacacaacgagatcgtcttgcacaacaaatgtctc
atcggcacggtcaactcacacgtctcgcacttcgaggacgccgtcgagaccttacaggaa
cttccggcgtggctgctcgatgatttagtcacgacggttaccgacccggaacacgtcgag
gctgccttcgaggatggggacgatcaaataaaagcagtcgtcgagttcgattcgctgtaa

DBGET integrated database retrieval system