KEGG   Haloarcula marismortui: rrnAC1593Help
Entry
rrnAC1593         CDS       T00211                                 

Gene name
rpl18P
Definition
(GenBank) 50S ribosomal protein L18P
  KO
K02881  large subunit ribosomal protein L18
Organism
hma  Haloarcula marismortui
Pathway
hma03010  Ribosome
Module
hma_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:hma00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    rrnAC1593 (rpl18P)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hma03011]
    rrnAC1593 (rpl18P)
Ribosome [BR:hma03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    rrnAC1593 (rpl18P)
  Bacteria
    rrnAC1593 (rpl18P)
  Archaea
    rrnAC1593 (rpl18P)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5e Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: AAV46511
UniProt: P14123
Structure
PDB: 

Position
I:complement(1432479..1433042)
Genome map
AA seq 187 aa AA seqDB search
MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLA
SAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQ
EGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETL
LDGDIEL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaggaccacgatataaagtaccgatgcggcgacgccgcgaggccagaaccgat
taccatcagcggttgcgcctgttgaaatccggtaagccacgtctcgttgctcgaaagagc
aataaacacgtcagggcgcagctggtgacgcttggccccaacggcgatgacactctcgcg
tccgctcactcgagcgatctcgccgagtacggctgggaggccccgacgggcaacatgccc
tcggcatacctcaccggtctgctcgccgggcttcgcgcgcaggaagcgggcgtcgaggag
gcagtgcttgacatcggactcaacagcccgacccccggaagcaaagtattcgcaatacag
gaaggcgcaatcgacgccggcctggacattccgcacaacgacgacgtactcgccgactgg
cagcgcacgcgcggtgcccacatcgccgagtacgacgagcagctcgaggagccgctgtac
agcggcgacttcgacgctgcagacctcccggagcacttcgacgagctccgagagacccta
ctggacggtgacatcgaactatga

DBGET integrated database retrieval system